KEGG   Streptomyces coelicolor: SCO1087Help
Entry
SCO1087           CDS       T00085                                 

Gene name
2SCG4.03c
Definition
(RefSeq) aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO1087 (2SCG4.03c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SCO1087 (2SCG4.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1096510
NCBI-ProteinID: NP_625381
Kitasato: SCO1087
UniProt: Q9K3R1
Position
complement(1146486..1147556)
Genome map
AA seq 356 aa AA seqDB search
MNPPKTDARRHHDPEVRGFASDNYAGAHPEVLAALALANGGHQVAYGEDDYTENLQRVIR
SHFGSGAEAFPVFNGTGANVVALQAVTDRWGAVICAESAHINVDEGGAPERMGGLKLLTV
PTPDGKLTPELIDRQAYGWDDEHRAMPQVVSITQSTELGTLYTPDEIRAVCEHAHAHGMK
VHLDGSRIANAAASLDVPMRTFTNAVGVDLLSLGGTKNGALFGEAVVVLNQDAVRHMKHL
RKLSMQLASKMRFVSVQLEALLAKDLWLRNARHSNEMAQRLAEGVRAVHGVEILYPVQAN
AVFARLPHEVSERLQKRFRFYFWDEAAGDVRWMCAFDTTENDVDAFVSALKEEMAR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaccgaagaccgacgcgcgtcgccatcacgaccccgaggtccgcggtttcgcc
agtgacaactacgccggggctcacccggaagtactcgccgcgctggcgctggccaacggc
gggcaccaggtcgcgtacggcgaggacgactacaccgagaacctccagcgcgtgatccgc
agccacttcggctccggcgccgaggcgttcccggtcttcaacggcaccggcgccaacgtc
gtcgcgctccaggcggtcaccgaccgctggggcgcggtgatctgcgccgagagcgcgcac
atcaacgtcgacgagggcggcgcccccgagcgcatgggcggcctcaagctgctcaccgtc
cccacccccgacggcaagctcacgcccgagctgatcgaccgccaggcctacggctgggac
gacgagcaccgggcgatgccgcaggtcgtctcgatcacccagagcaccgagctgggcacc
ctctacacgcccgacgagatccgcgccgtctgcgagcacgcccacgcgcacggcatgaag
gtgcacctggacggctcccggatagccaacgccgccgcctcgctggacgtgcccatgcgc
acgttcaccaacgcggtcggcgtcgacctcctctccctcggcggcaccaagaacggcgcg
ctgttcggcgaggcggtcgtcgtcctgaaccaggacgccgtgcgccacatgaagcacctg
cgcaagctgtccatgcagctggcctccaagatgcgcttcgtgtccgtgcagctggaggcg
ctgctggccaaggacctgtggctgcgcaacgcccggcactccaacgagatggcccagcgc
ctggccgagggcgtgcgcgccgtgcacggcgtggagatcctctacccggtgcaggccaac
gcggtcttcgcccggctgccgcacgaggtgagcgagcgcctgcagaagcggttccgcttc
tacttctgggacgaggccgccggcgacgtgcgctggatgtgcgccttcgacaccaccgag
aacgacgtcgacgctttcgtgtccgccctcaaggaagagatggcgcgctga

DBGET integrated database retrieval system