KEGG   Streptomyces coelicolor: SCO1170Help
Entry
SCO1170           CDS       T00085                                 

Gene name
2SCG11.04, SCG11A.01, xylB
Definition
(RefSeq) xylulose kinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00040  Pentose and glucuronate interconversions
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO1170 (2SCG11.04)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     SCO1170 (2SCG11.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG HSP70
Motif
Other DBs
NCBI-GeneID: 1096593
NCBI-ProteinID: NP_733525
Kitasato: SCO1170
UniProt: Q9RK00
Position
1231648..1233093
Genome map
AA seq 481 aa AA seqDB search
MSAAEGPLVVGVDTSTQSTKALVVDAATGRVVASGQAPHTVSSGTGRESDPRQWWDALGE
ALSQCGEAAREAAAVSVGGQQHGLVTLDARGEPVRPALLWNDVRSAPQARRLIDELGGAK
AWAERTGSVPSASFTVTKWAWLTEHEPEAARAVKAVRLPHDYLTERLTGEGTTDRGDVSG
TGWWASGTEAYDEEILARVALDPALLPRVVRPGEVAGTVRDGHGLPFSKGTLVAAGTGDN
AAAALGLGLRPGVPVMSLGTSGTAYAVSQRRPADPTGTVAGFADARGDWLPLACTLNCTL
AVDRVASLLGLDREAVEPGTDVTLLPFLDGERTPNLPHSSGLLHGLRHDTTAGQLLQAAY
DGAVHSLLGALDLVLDADADPSAPLLLIGGGARGTAWQQTVRRLSGRPVQIPEARELVAL
GAAAQAAGLLTGEDAAAVARRWNTAAGPVLDAVERDEATLNRITGVLSDAAPLLERDAAS
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagccgagggtccgctcgtcgtcggcgtggacacgtccacccagtccaccaag
gcgctggtcgtcgacgcggccaccggccgggtcgtcgcgagcggccaggcgccccacacc
gtgtcctccgggaccggccgcgagagcgatccccgccagtggtgggacgcgctgggcgag
gccctgagccagtgcggcgaggccgcccgcgaggccgccgcggtgtccgtcggcgggcag
cagcacggtctggtcacgctggacgcccggggcgagccggtgcgccccgccctgctctgg
aacgacgtgcgctcagctccgcaggcccgccggctgatcgacgagctgggcggggccaag
gcctgggcggagcgcacggggagcgtgcccagcgcctccttcacggtcaccaagtgggcc
tggctgaccgagcacgagccggaggcggcccgcgcggtgaaggccgttcggctcccccac
gactacctcaccgagcgcctcaccggcgaggggaccaccgaccgcggggacgtgtccggc
accggctggtgggcgtcgggcacggaggcctacgacgaggagatcctcgcgcgcgtggcg
ctcgatccggccttgctgccccgggtggtccggcccggtgaggtggccggcaccgtacgc
gacggccacggcctgccgttctccaagggcactctggtcgccgccggcaccggcgacaac
gcggccgccgcgctgggtctcggactgcgccccggcgtcccggtcatgagtctcggcact
tcgggcacggcctacgccgtgtcgcagcgtcggcccgccgacccgacgggcaccgtggcg
ggcttcgccgacgcgcgcggcgactggctgccgctggcctgcaccctcaactgcacgctc
gccgtggaccgcgtcgcgtccctgctgggcctggaccgggaagccgtcgagccgggcacc
gacgtcaccctgctgcccttcctcgacggcgagcgcacaccgaacctcccgcactcctcc
ggcctcctgcacgggctgcgccacgacacgaccgccggacagctgctccaggccgcgtac
gacggcgccgtccactcgctgctcggcgcgctcgacctcgtcctcgacgccgacgcggac
ccgtccgcgcccctgctgctgatcggcggcggtgcccgggggacggcctggcagcagacg
gtacggcggctgtccgggcgcccggtccagatcccggaggccagggagctggtcgcgctc
ggtgccgcggcgcaggcggccggtctgctgaccggcgaggacgcggcagcggtcgcccga
cgctggaacacggccgccgggccggtactcgacgccgtggaacgggacgaggcgacgctg
aaccggatcaccggggtactctccgacgcggcaccgctgctggaacgggacgcggcctcc
cgctga

DBGET integrated database retrieval system