KEGG   Streptomyces coelicolor: SCO1214Help
Entry
SCO1214           CDS       T00085                                 

Gene name
2SCG58.14, pfkA3
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00051  Fructose and mannose metabolism
sco00052  Galactose metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1214 (2SCG58.14)
   00030 Pentose phosphate pathway
    SCO1214 (2SCG58.14)
   00051 Fructose and mannose metabolism
    SCO1214 (2SCG58.14)
   00052 Galactose metabolism
    SCO1214 (2SCG58.14)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO1214 (2SCG58.14)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCO1214 (2SCG58.14)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SCO1214 (2SCG58.14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 1096637
NCBI-ProteinID: NP_625503
Kitasato: SCO1214
UniProt: Q9FC99
Position
1285457..1286482
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFRDGWKGLLECDYLKLDLDAVGGI
LARGGTILGSSRVRPEHLRDGVERARGHVEELGLDAIIPIGGEGTLKAARLLSDNGLPIV
GVPKTIDNDIAVTDVTFGFDTAVTVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAVVVPERPFDIDELTAKVGERFSAGKRFAIVVAAEGAKPKAGTMDFDEGGKDV
YGHERFAGIARQLSIELEERLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAVHR
GEFGKMTALRGTDIEMVSLADAVESLKTVPDARYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtgtcctcacgtccggcggcgactgccccggcctgaacgccgtcatccgg
tccgtcgtgcaccgcgccgtcgtcgaccacggcgacgaggtcatcggtttccgggacggc
tggaagggcctcctggagtgcgactacctcaagctcgacctcgacgcggtcggcggcatc
ctggcgcgcggcggcaccatcctcggctcctcccgggtccgacccgaacacctgcgggac
ggcgtggagcgggcccggggacacgtcgaggaactcggcctcgacgcgatcatcccgatc
ggcggcgagggcacgctgaaggcggcccggctgctgtccgacaacggcctgccgatcgtg
ggcgtgccgaagaccatcgacaacgacatagcggtcaccgacgtcaccttcggcttcgac
accgcggtgaccgtcgccaccgaggccctggaccggctgaagaccaccgccgagtcccac
cagcgggtgctgatcgtcgaggtcatgggccggcacaccggctggatcgcgctgcactcg
ggcatggccgcgggtgcgcacgccgtcgtcgtcccggagcggcccttcgacatcgacgag
ctgaccgcgaaggtcggggagcgtttctccgcgggcaagcggttcgcgatcgtggtggcc
gcggagggtgccaagccgaaggccgggaccatggacttcgacgagggcggcaaggacgtc
tacggccacgagcgcttcgccgggatcgcccgccagctctccatcgagctggaggagcgg
ctcggcaaggaggcccggccggtgatactcgggcacgtccagcgcggcggcacgccgacg
gcgtacgaccgggtgctggcgacgcggttcgggtggcacgcggtggaggcggtgcaccgc
ggggagttcgggaagatgacggccctgcgcgggacggacatcgagatggtgtcgctcgcc
gacgcggtggagtcgttgaagacggtgccggacgcgcggtacgcggaagcggagtgtgtt
ctctga

DBGET integrated database retrieval system