KEGG   Streptomyces coelicolor: SCO1228Help
Entry
SCO1228           CDS       T00085                                 

Gene name
2SCG1.03
Definition
(RefSeq) acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sco  Streptomyces coelicolor
Pathway
sco00561  Glycerolipid metabolism
sco00564  Glycerophospholipid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO1228 (2SCG1.03)
   00564 Glycerophospholipid metabolism
    SCO1228 (2SCG1.03)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO1228 (2SCG1.03)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SCO1228 (2SCG1.03)
Lipid biosynthesis proteins [BR:sco01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SCO1228 (2SCG1.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase DUF1541
Motif
Other DBs
NCBI-GeneID: 1096651
NCBI-ProteinID: NP_625516
Kitasato: SCO1228
UniProt: Q9FCD9
Position
1302287..1303009
Genome map
AA seq 240 aa AA seqDB search
MFYYVLKYVLLGPLLRVVFRPRIEGLDHVPGSGAAIVAGNHLSFSDHFLMPAVLRRRITF
LAKAEYFTGPGLKGRLTAFFFRSAGQIPVDRSGKEAGQAAIREGLGVLGRGELLGIYPEG
TRSHDGRLYKGKVGVAVMALRAGVPVVPCAMIGTFEAQPPGRKIPKLHPVVIRFGEPLDF
SRYAGMEGEKAVLRAVTDEIVYAILSLSGQEYVDRYAADVKAEEAERAAQGRRFPRLPHR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgttctactacgtgctcaagtacgtactgctgggcccgctgctgagggtcgtcttccgc
ccccggatcgaggggctcgaccatgtgccgggatcgggggcggccatcgtcgcgggcaac
cacctctccttctcggaccacttcctcatgcccgcggtgctcaggcgccgcatcaccttc
ctggccaaggcggagtacttcaccgggccgggcctcaagggcagactgaccgcgttcttc
ttccgcagcgcggggcagatcccggtggaccgctcgggcaaggaggcggggcaggccgcg
atccgcgaggggctcggcgtgctgggccggggcgagttgctcggcatctatccggagggc
acccgctcgcacgacggccggctatacaagggcaaggtcggcgtggcggtgatggcgctc
agggccggggtgccggtcgtgccctgcgcgatgatcggcaccttcgaggcgcagccgccg
ggccggaagatcccgaagctgcacccggtggtcatccgcttcggcgaacccctcgacttc
tcccgctatgcgggcatggagggcgagaaggccgtactgcgcgccgtcaccgacgagatc
gtctacgcgatcctctccctctccggtcaggagtacgtcgaccggtacgcggcggacgtg
aaggccgaggaggccgagcgggcggcgcagggccgcaggttcccccggctgccgcaccgc
tag

DBGET integrated database retrieval system