KEGG   Streptomyces coelicolor: SCO1254Help
Entry
SCO1254           CDS       T00085                                 

Gene name
2SCG1.29, 2SCG18.01, purB
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
sco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO1254 (2SCG1.29)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1254 (2SCG1.29)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     SCO1254 (2SCG1.29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C Cytidylate_kin2
Motif
Other DBs
NCBI-GeneID: 1096677
NCBI-ProteinID: NP_733528
Kitasato: SCO1254
UniProt: Q8CK34
Position
1325285..1326727
Genome map
AA seq 480 aa AA seqDB search
MTSAPAKPRIPNVLAGRYASAELATLWSPEHKVKLERQLWLAVLRAQKDLGIEVPDAAIA
DYERVLNQVDLASIAEREKVTRHDVKARIEEFNDLAGHEHVHKGMTSRDLTENVEQLQIR
LSLELVRDRSVAVLARLGKLAGEYGELVMAGRSHNVAAQATTLGKRFASAADELLVAYGR
VEELLGRYPLRGIKGPVGTAQDMLDLLGGDAGKLADLEQRIAGHLGFSQAFTSVGQVYPR
SLDYEVVTALVQLAAAPSSLAKTIRLMAGHELVTEGFKPGQVGSSAMPHKMNTRSCERVN
GLTVILRGYASMTGELAGDQWNEGDVSCSVVRRVALPDAFFALDGLLETFLTVLDEFGAF
PAVVARELDRYLPFLATTKVLMGAVRGGVGREVAHEAIKENAVASALAMREQGAERNELL
DKLAADDRIPLDRAALDALMADKLSFTGAAADQVGVVVGRIEDIVKRHPQAAGYTPGAIL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccgctcccgccaagccccgcatcccgaacgtcctcgccggacgctacgcctcc
gccgagctcgccaccctctggtcgcccgagcacaaggtgaagctcgagcggcagctctgg
ctcgccgtgctgcgggcccagaaggacctgggcatcgaggtgcccgacgccgcgatcgcc
gactacgagcgcgtcctcaaccaggtcgacctggcctcgatcgccgagcgcgagaaggtc
acgcggcacgacgtgaaggcgcggatcgaggagttcaacgacctcgccgggcacgagcac
gtccacaagggcatgacctcccgcgacctgacggagaacgtcgagcagctccagatccgg
ctctcgctggagctggtccgggaccgttccgtggccgtcctggcccgcctcggcaagctg
gccggcgagtacggcgagctggtcatggccggccgctcgcacaacgtggcggcgcaggcg
acgacgctgggcaagcggttcgccagcgccgccgacgagctgctcgtggcgtacggccgg
gtggaggagctgctcggccgctacccgctgcgcggcatcaagggcccggtcggcaccgcc
caggacatgctggacctgctcggcggtgacgcgggcaagctggcggacctggagcagcgg
atcgccgggcacctcggcttctcgcaggcgttcacctcggtcggccaggtgtacccgcgc
tccctggactacgaggtcgtcaccgcgctggtgcagctcgccgccgcgccgtcctcgctg
gccaagacgatccgcctgatggccgggcacgagctggtcaccgagggcttcaagcccggc
caggtcggctcgtccgcgatgccgcacaagatgaacacccgttcctgcgagcgcgtcaac
ggcctgacggtgatcctgcgcggctacgcctcgatgaccggtgagctggcgggcgaccag
tggaacgagggcgacgtgtcctgctcggtggtgcgccgggtggcgctccccgacgccttc
ttcgcgctggacgggctgctggagacgttcctgaccgtgctcgacgagttcggcgccttc
ccggccgtcgtggcccgggagctggaccgctacctgccgttcctggccaccaccaaggtg
ctgatgggcgcggtgcgcggcggtgtgggccgcgaggtcgcgcacgaggcgatcaaggag
aacgcggtcgcctccgcgctggccatgcgcgagcagggcgccgagcgcaacgagctgctc
gacaagctggccgccgacgaccgcatcccgctggaccgtgccgccctggacgcgctgatg
gccgacaagctctccttcaccggcgccgcggccgaccaggtcggtgtggtcgtcggccgg
atcgaggacatcgtcaagcggcacccgcaggccgccggttacacccccggagcgatcctc
tga

DBGET integrated database retrieval system