KEGG   Streptomyces coelicolor: SCO1284Help
Entry
SCO1284           CDS       T00085                                 

Gene name
2SCG18.31c
Definition
(RefSeq) aminotransferase
  KO
K09251  putrescine aminotransferase [EC:2.6.1.82]
Organism
sco  Streptomyces coelicolor
Pathway
sco00330  Arginine and proline metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO1284 (2SCG18.31c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO1284 (2SCG18.31c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.82  putrescine---2-oxoglutarate transaminase
     SCO1284 (2SCG18.31c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO1284 (2SCG18.31c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1096707
NCBI-ProteinID: NP_625571
Kitasato: SCO1284
UniProt: Q9K3F7
Position
complement(1354527..1355912)
Genome map
AA seq 461 aa AA seqDB search
MTVSPPSTASTASTGSTGSTGSTATTGPSAGLAAPPSEPSAPRAGTAAPTGRPDIVDLYL
KHIGSGRAVMGRVMGGMAEVRSEGVWIHADDGRRFLDFGGYGVFIMGHRHPAVVEAVHRQ
IDTHPLASRVLLEPVAARAAQALAAHTPPGLDYVHFVNSGAEATEAALKLARAHGLTSVI
TTRSGFHGKTLGALSVTANTTYQTPFQPLLPDVTQVAYDDPADLEQALAAHRDRACVIVE
PVQGEGGVRIPRPGYLGQVRALCRTYGALLVVDEIQTGMGRLGTWWGVDAEDVRPDVLLV
GKGLSGGVVPVAAMVATAEAYAPFSRDPYLHTSTFGASPIACAAALATVRAMEEEDTVAR
AAALGPRILTAVRDVCAPYQGGLVREVRGRGLLIGIEFAEEQAVGELMLELISRGVLVNN
SLNSTRVLRLTPPAVVEDSALDLFLTTLGAALRGTADRMTG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtcacccccgtccaccgcgtccaccgcgtccaccgggtccaccgggtccacc
gggtccactgcgaccaccgggccgtccgccgggttggccgccccgccctccgagccctcc
gccccgcgtgccggaaccgccgcgccgaccggccggcccgacatcgtggacctctacctg
aagcacatcggctccggccgcgccgtgatgggccgtgtcatgggcggcatggccgaggtc
cgctccgagggggtctggatccacgccgacgacggccgccgcttcctggacttcggcggc
tacggcgtcttcatcatgggccaccgccacccggccgtcgtcgaagcggtgcatcggcag
atcgacacccacccgctggccagccgcgtcctcctcgaacccgtcgccgcccgggccgcc
caggccctggccgcccacactccgcccggcctcgactacgtccacttcgtcaactccggc
gccgaggccaccgaggcggccctgaaactggcccgcgcccacggactcacctcggtgatc
accacccgcagcggcttccacggcaagaccctcggcgcgctgagcgtcaccgccaacacc
acgtaccagacgcccttccagcccctgctcccggacgtcacccaggtggcctacgacgac
ccggccgacctcgaacaggcgctggccgcccaccgcgaccgggcctgcgtcatcgtcgaa
cccgtccagggcgagggcggcgtacgcatcccccgccccggctacctcggccaggtgcgg
gcgctgtgccggacgtacggcgccctgctggtcgtcgacgagatccagaccggcatggga
cggctgggcacctggtggggcgtcgacgccgaggacgtgcgtccggacgtactgctcgtc
ggcaagggactcagcggcggtgtcgtaccggtcgccgcgatggtcgccaccgcggaggcc
tacgcccccttcagccgcgacccctacctgcacacctccaccttcggcgcctcgccgatc
gcctgcgccgccgccctcgccaccgtacgggccatggaggaggaggacaccgtggcgcgg
gccgccgcgctcggcccgcgcatcctcaccgccgtacgggacgtgtgcgcgccgtaccag
ggcgggctggtccgcgaagtgcgcggccggggtctgctgatcggcatcgagttcgccgaa
gaacaggcggtcggcgaactcatgctggaactcatctcccgcggtgtgctcgtcaacaac
tccctcaactccacccgggtgctgcggctgaccccgccggccgtggtcgaggactccgcg
ctcgacctgttcctcaccaccctcggcgcggccctgcgcggcacggccgaccgcatgacc
ggctga

DBGET integrated database retrieval system