KEGG   Streptomyces coelicolor: SCO1294Help
Entry
SCO1294           CDS       T00085                                 

Gene name
SCBAC36F5.05c
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1294 (SCBAC36F5.05c)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO1294 (SCBAC36F5.05c)
Enzymes [BR:sco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     SCO1294 (SCBAC36F5.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1096717
NCBI-ProteinID: NP_625580
Kitasato: SCO1294
UniProt: Q93IX6
Position
complement(1368938..1370161)
Genome map
AA seq 407 aa AA seqDB search
MDSARTHTSPPDDVRFTAPAGRALATEAVHAGRDDLAAQGLHAPPIDLSTTYPSYDSRGE
AARIDAFAATGAEPDGPPVYGRLGNPTVARFETALARLEGTEAAVAFASGMAALSAVLLV
RGSMGLRHVVAVRPLYGCSDHLLTAGLLGSEVTWTDPAGVADALRPDTGLVLVESPANPT
LAEVDLRAVAHACGSVPLLVDNTFATPVLQRPAEHGARLVLHSATKYLGGHGDVLAGVVA
CDEEFAGRLRQVRFATGGVLHPLAGYLLLRGLSTLPVRVRAASANAADLAGRLAADPRVA
RVHYPRIGGAMVSFEVHGDPHAVIGGVRLITPAVSLGSVDTLIQHPASISHRIVDADDRR
GAGVGDRLLRLSVGLEDVDDLWADLDRALGERAAGAVSPREALSRAD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggactcagcgcgcacgcacacgtcaccacccgacgacgtacgcttcaccgcacccgcg
ggcagggcactggccaccgaagccgtgcacgccggccgcgacgacctcgccgcccaggga
ctgcacgccccgcccatcgacctgtccacgacctacccgtcgtacgacagccgcggcgag
gccgcccgcatcgacgcgttcgccgcgaccggtgccgagccggacgggccgcccgtctac
ggccgcctcggcaacccgaccgtcgcccgcttcgagacggcactggcccggctggagggg
acggaggccgcagtcgccttcgccagcggcatggccgcgctgagcgccgtactgctggtc
cgcggctcgatggggctccgtcacgtcgtcgccgtacggcccctgtacggctgcagcgac
cacctgctgaccgccgggctgctcgggtccgaggtcacctggaccgacccggcgggcgtc
gccgacgcgctgcgcccggacaccggactggtgctcgtggagtcgccggccaacccgacg
ctggccgaggtcgacctgcgggccgtcgcccacgcctgcgggtcggtgccgctgctcgtg
gacaacaccttcgccacgcccgtgctccagcgccccgccgagcacggggcccggctggtg
ctgcacagcgccaccaagtacctgggcgggcacggggacgtactggcgggcgtggtcgcc
tgcgacgaggagttcgccgggcggctgcggcaggtccgcttcgccacgggcggagtgctg
cacccgctggccggctacctcctgctgcgtgggctgtccaccctgcccgtgcgggtacgg
gccgcctccgccaacgccgccgacctggccgggcggctggccgccgacccgcgggtggcc
cgcgtccactacccgcgcatcggcggtgcgatggtctccttcgaggtccacggcgacccg
cacgcggtcatcggcggcgtccggctgatcaccccggccgtgagcctcggcagcgtcgac
acgctcatccagcacccggcgtcgatcagccaccgcatcgtggacgcggacgaccggcgg
ggggccggggtcggcgaccggctgctgcggctgtcggtcggcctggaggacgtcgacgac
ctgtgggccgacctggaccgggccctgggggagcgggcggccggggccgtctcgccgcgg
gaggcgctgtcgcgggccgactga

DBGET integrated database retrieval system