KEGG   Streptomyces coelicolor: SCO1378Help
Entry
SCO1378           CDS       T00085                                 

Gene name
SC10A9.20c
Definition
(RefSeq) glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO1378 (SC10A9.20c)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO1378 (SC10A9.20c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SCO1378 (SC10A9.20c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1096801
NCBI-ProteinID: NP_625662
Kitasato: SCO1378
UniProt: Q9AK84
Position
complement(1454780..1457665)
Genome map
AA seq 961 aa AA seqDB search
MTAHRTPLSELEQAMPFEQRHIGPDHEARAKMLAQVGYGSLDELTAAAVPDVIKNADRLD
LPGARSEAEVLAELRSLADRNQVLDSMIGLGYYGTFTPPVILRNVMENPAWYTAYTPYQP
EISQGRLEALLNFQTMVAELTGLPTSGASLLDEGTAAAEAMALSRRMGKNKKGLFLVDAD
ALPQTVAVIRTRAEPTGVEVVVADLSEGIPAEVAEREINGVLLQYPGASGAVRDIKPVID
RAHELGALVTVAADLLALTLLTSPGELGADIAVGTTQRFGVPMGFGGPHAGYMAVHEKFA
RSLPGRLVGVSVDADGNKAYRLALQTREQHIRREKATSNICTAQVLLAVMAGMYAVYHGP
EGLRAIARRTHRYATITAAGLAAGGVEIVHGSYFDTVTARVPGRAAGIVHAARENGINLR
LVDADHVSFACDETTTRAQVGGVWHAFGVEGDIESLDAEAGETLPEALLRTDDFLTHPVF
HQHRSETAMLRYLRRLADRDYALDRGMIPLGSCTMKLNATTEMEPVTWPEFGALHPFAPA
EQAQGYLTLIRELEERLAEVTGYDKVSLQPNAGSQGEFAGLLAVRGYHRANGDEQRTVCL
IPSSAHGTNAASAVMAGMKVVVVKTAEDGEIDVEDLRAKIDKHRDELAVLMITYPSTHGV
FEEHVADICAQVHDAGGQVYVDGANLNALVGLAKPGHFGGDVSHLNLHKTFCIPHGGGGP
GVGPVGVRSHLAPYLPNHPLQPAAGPQTGVGPISAAPWGSAGILPISWSYVRLMGGEGLK
RATQVAVLSANYIAKRLEPHFPVLYNGPGGLVAHECIIDLRPLTKATGVSVDDVAKRLID
YGFHAPTMSFPVAGTLMIEPTESEDLAELDRFCEAMIAIRAEIEKVGSGAWPADDNPLRG
APHTADALGGEWDHAYTREEAVFPAGVSAADKYWPPVRRIDQAYGDRNLVCSCPPLDAYE
D
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccaccgcactccgctctccgaactcgaacaggccatgcccttcgagcagcgc
cacatcggccccgatcacgaggcccgggccaagatgctcgcgcaggtcggttacggttcg
ctcgacgaactgacggccgccgcggtgccggatgtgatcaagaacgccgaccggctggat
ctgccgggcgcgcgctccgaggccgaggtgctggccgagctgcgctccctggccgaccgc
aaccaggtcctcgactccatgatcggcctcggctactacggcaccttcaccccgccggtc
atcctgcgcaacgtcatggagaacccggcctggtacacggcgtacacgccctaccagccg
gagatctcccagggccgtctcgaagccctgctgaacttccagacgatggtcgccgagctc
accggactgcccacctccggcgcctcgctgctcgacgagggcaccgccgccgccgaggcg
atggccctctcccggcgcatgggcaagaacaagaagggcctgttcctggtcgacgcggac
gccctgccgcagaccgtcgccgtgatacggacccgcgccgagccgaccggcgtcgaggtc
gtcgtcgccgacctgagcgagggcatccccgccgaggtcgccgagcgcgagatcaacggc
gtcctgctccagtacccgggcgcctccggagccgtccgcgacatcaagccggtgatcgac
cgggcgcacgaactcggcgcgctcgtcaccgtcgccgccgacctgctcgccctcaccctg
ctcacctcgcccggcgagctgggcgcggacatcgcggtgggcaccacccagcgcttcggc
gtgccgatgggcttcggcggaccgcacgccggctacatggcggtgcacgagaagttcgcc
cgcagcctccccggccgcctggtcggcgtctccgtcgacgccgacggcaacaaggcctac
cgcctggctctgcagacccgcgagcagcacatccgccgcgagaaggccaccagcaacatc
tgcaccgcgcaggtgctgctcgccgtcatggccggcatgtacgccgtctaccacggcccc
gagggcctgcgggccatcgcccgccgaacccaccggtacgccacgatcaccgccgccggc
ctcgccgcgggcggcgtcgagatcgtccacggctcctacttcgacaccgtcaccgcgcgg
gtgcccggccgggccgccgggatcgtgcacgccgcccgcgagaacggcatcaacctgcgg
ctcgtcgacgccgaccacgtgtcgttcgcctgcgacgagaccaccacgcgcgcccaggtc
ggcggcgtgtggcacgccttcggcgtggagggcgacatcgagtcgctggacgcggaggcc
ggggagacgctgcccgaggcgctgctgcgcaccgacgacttcctcacccaccccgtcttc
caccagcaccgctccgagaccgcgatgctgcgctacctgcgccgcctcgccgaccgggac
tacgcgctggaccgcggcatgatcccgctgggctcctgcaccatgaagctcaacgcgacc
accgagatggagccggtcacctggcccgagttcggcgcgctgcaccccttcgcgcccgcc
gagcaggcgcagggctacctcaccctcatccgcgagctggaggagcggctcgccgaggtc
accgggtacgacaaggtctcgctccagccgaacgccgggtcgcagggcgagttcgcgggc
ctgctcgccgtacgcggctaccaccgggccaacggcgacgagcagcgcaccgtctgcctc
atcccgtcctcggcgcacggcaccaacgccgccagcgccgtgatggccggcatgaaggtc
gtcgtcgtcaagaccgccgaggacggcgagatcgacgtcgaggacctgcgcgccaagatc
gacaagcaccgcgacgagctggccgtgctgatgatcacctacccgtccacgcacggcgtg
ttcgaggagcacgtcgccgacatctgcgcgcaggtgcacgacgcgggcggccaggtctac
gtggacggcgccaacctcaacgccctggtcggcctcgccaagcccggccacttcggcggc
gacgtctcccacctgaacctgcacaagaccttctgcatcccgcacggcggcggcggcccc
ggcgtgggccccgtcggcgtacggtcgcacctggcgccgtacctgcccaaccacccgctg
cagcccgcggccggtccgcagacgggcgtcggcccgatctcggcggcgccgtggggctcg
gccggcatcctgccgatctcctggtcctacgtccgcctgatgggcggcgagggcctcaag
cgcgccacgcaggtcgccgtgctgtccgccaactacatcgccaagcgcctggagccgcac
ttcccggtgctctacaacggccccggcgggctggtcgcgcacgagtgcatcatcgacctg
cgcccgctgaccaaggccaccggcgtgagcgtcgacgacgtcgccaagcggctgatcgac
tacggcttccacgcgccgacgatgtccttcccggtggccggcacgctgatgatcgagccg
accgagtccgaggacctggccgagctggaccggttctgcgaggcgatgatcgccatccgc
gcggagatcgagaaggtcggctccggcgcctggcccgccgacgacaacccgctgcgcggc
gccccgcacaccgcggacgcgctcggcggtgagtgggaccacgcgtacacccgcgaggag
gccgtcttcccggccggggtgtccgccgccgacaagtactggccgccggtgcgccgcatc
gaccaggcctacggcgaccggaacctggtctgctcctgcccgccgctggacgcgtacgag
gactga

DBGET integrated database retrieval system