KEGG   Streptomyces coelicolor: SCO1393Help
Entry
SCO1393           CDS       T00085                                 

Gene name
acsA, SC1A8A.13c
Definition
(RefSeq) acetoacetate-CoA ligase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO1393 (acsA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO1393 (acsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO1393 (acsA)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     SCO1393 (acsA)
Lipid biosynthesis proteins [BR:sco01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCO1393 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1096819
NCBI-ProteinID: NP_625676
Kitasato: SCO1393
UniProt: Q9KZN9
Position
complement(1477596..1479572)
Genome map
AA seq 658 aa AA seqDB search
MSTENPQPLWQPDAQRIAQARITRFQAWAAEHHGAPAEGGYAALHRWSVDELDTFWKAVT
EWFDVRFSTPCARVLGDRTMPGAQWFPGATLNYAEHALRAAGTRPDEPALLYVDETHEPA
PVTWAELRRQVASLAAELRALGVRPGDRVSGYLPNIPQAVVALLATAAVGGVWTSCAPDF
GARSVLDRFQQVEPVVLFTVDGYRYGGKEHDRRDTVAELRRELPTLRAVIHIPLLGTEAP
DGALDWETLTAADAEPVYEQVPFDHPLWVLYSSGTTGLPKAIVQSQGGILVEHLKQLGLH
CDLGPGDRFFWYTSTGWMMWNFLVSGLLTGTTIVLYDGSPGFPATDAQWRIAERTGATLF
GTSAAYVMACRKAGVHPARDLDLSAIQCVATTGSPLPPDGFRWLHDEFAAGGADLWIASV
SGGTDVCSCFAGAVPTLPVHIGELQAPGLGTDLQSWDPSGNPLTDEVGELVVTNPMPSMP
IRFWNDPDGSRYHDSYFDTYPGVWRHGDWITLTSRGSVVIHGRSDSTLNRQGVRMGSADI
YEAVERLPEIRESLVIGIEQPDGGYWMPLFVHLAPGATLDDALLDRIKRTIRANLSPRHV
PDEVIEVPGIPHTLTGKRIEVPVKRLLQGTPLDKAVNPGSIDNLDLLHFYEELARKRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgagaacccacagccgctctggcagccagatgcgcaacgcatcgcccaggca
cgcatcaccaggttccaggcctgggcggccgagcaccacggagcccccgccgagggcgga
tacgccgccctgcaccgctggtccgtcgacgagctggacaccttctggaaagccgtcacg
gagtggttcgacgtccgcttctccaccccctgcgcgcgcgtgctcggcgaccggaccatg
cccggcgcccagtggtttcccggcgccacgctgaactacgccgaacacgccctgcgcgcg
gccggcacccgcccggacgaaccagccctcctgtacgtcgacgagacccacgaaccggcc
cccgtcacctgggcagagctgcgccgccaggtcgcctccctcgccgccgaactgcgcgcc
ctcggcgtacgccccggcgaccgcgtcagcgggtacctccccaacatcccgcaggccgtg
gtcgcgctgctcgccacggccgccgtgggcggcgtctggacctcctgcgcgcccgacttc
ggcgcccgcagcgtcctcgaccgcttccagcaggtcgaacccgtcgtcctgttcaccgtc
gacggctaccgctacgggggcaaggaacacgaccgccgcgacaccgtcgccgaactccgc
cgggaactgcccaccctccgcgcggtgatccacatcccgctcctcggcaccgaggccccg
gacggcgcgctggactgggagaccctcaccgccgcggacgccgagccggtgtacgagcag
gtgcccttcgaccaccccctgtgggtgctctactcctccggcaccaccggcctgcccaag
gccatcgtccagtcccagggcggcatcctcgtcgagcacctcaagcagctcggcctgcac
tgcgacctcggccccggggaccgcttcttctggtacacctcgaccggctggatgatgtgg
aacttcctcgtctccggcctgctcaccggcaccacgatcgtcctctacgacggcagcccc
ggcttccccgccaccgacgcccagtggcgcatcgcggaacgcaccggcgccacccttttc
ggcacctccgccgcctacgtcatggcctgccgcaaggccggcgtccacccggcccgcgac
ctggacctctccgcgatccagtgcgtcgccaccaccggctccccgctcccgcccgacggc
ttccgctggctgcacgacgagttcgccgccggcggtgccgacctgtggatcgcctccgtc
agcggcggcaccgacgtgtgctcctgcttcgcgggcgccgtccccaccctccccgtccac
atcggcgaactccaggcccccggcctcggcaccgacctccagtcctgggacccgagcggc
aaccccctgaccgacgaggtcggcgagctggtcgtcaccaacccgatgccctcgatgccg
atccgcttctggaacgaccccgacggcagccgctaccacgacagctacttcgacacctac
cccggcgtctggcggcacggcgactggatcaccctcacctcccgcggctccgtcgtcatc
cacggccgctccgactccaccctcaaccgccaaggcgtccgcatgggctccgccgacatc
tacgaggccgtcgagcggctccccgagatcagggaatccctcgtcatcggcatcgaacag
cccgacggcggctactggatgcccctcttcgtgcacctggcacccggagccaccctcgac
gacgcgctcctggaccgcatcaagcggaccatccgcgccaacctctccccgcgccacgtc
cccgacgaggtcatcgaggtccccggcatcccgcacaccctcaccggcaaacgcatcgag
gtcccggtcaagcgcctcctccagggcaccccgctggacaaggcggtcaaccccggctcc
atcgacaacctcgacctgctccacttctacgaggaactcgcccgcaagcgctcctga

DBGET integrated database retrieval system