KEGG   Streptomyces coelicolor: SCO1438Help
Entry
SCO1438           CDS       T00085                                 

Gene name
hisG
Definition
(RefSeq) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01230  Biosynthesis of amino acids
Module
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO1438 (hisG)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     SCO1438 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C NMT1
Motif
Other DBs
NCBI-GeneID: 1096864
NCBI-ProteinID: NP_733534
Kitasato: SCO1438
UniProt: Q8CK28
Position
complement(1534876..1535733)
Genome map
AA seq 285 aa AA seqDB search
MLRIAVPNKGSLSGPAGEMLHEAGYQQRRESKELRIVDPVNEVEFFYLRPRDIAIYVSSG
KLDIGITGRDLLVDSGAHAEEILPLGFARSTFRFAGKPGAATGIDDLKGRTVATSYEGIV
AAHLADRGVDASVVHLDGAVETAIELGVAEVIADVVETGTSLRNAGLEVFGEPIMKSEAV
VIRRSDAEPDETTEPKVQQFLRRLQGVLVARTYVMMDYDCRVEQLEKAVALTPGLESPTV
SPLHNEGWVAVRAMVPAKEAQRIMDDLYEIGARAILTTAIHACRL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcatcgccgtccccaacaagggttccctgtcaggccccgcgggggagatgctg
catgaggccggctaccagcagcggcgcgagtccaaggagctgcggatcgtcgacccggtc
aacgaggtcgagttcttctacctccgcccccgcgacatcgcgatctacgtctcctcgggc
aagctcgacatcggcatcaccggccgcgacctgctggtcgactccggcgcccacgccgag
gagatcctcccgctcggcttcgcccgctccaccttccgcttcgccggcaagcccggcgcc
gccaccggcatcgacgacctcaagggccgcaccgtagccacctcctacgagggcatcgtc
gccgcccacctggccgaccggggcgtcgacgcctccgtcgtccacctggacggcgccgtc
gagaccgccatcgagctgggcgtcgccgaggtcatcgcggacgtcgtggagaccggcacc
tccctgcgcaacgccggcctggaggtcttcggcgagcccatcatgaagtccgaggccgtc
gtgatccgccgctcggacgcggagcccgacgagaccaccgaacccaaggtccagcagttc
ctgcgccgcctccagggcgtcctggtggcccggacctacgtgatgatggactacgactgc
cgggtcgagcagctggagaaggccgtcgcgctcacccccggcctggagtccccgaccgtg
tccccgctgcacaacgagggctgggtcgccgtgcgcgcgatggtcccggccaaggaggcc
cagcggatcatggacgacctgtacgagatcggcgcccgcgccatcctgaccacggccatc
cacgcctgccggctctga

DBGET integrated database retrieval system