KEGG   Streptomyces coelicolor: SCO1440Help
Entry
SCO1440           CDS       T00085                                 

Gene name
ribH
Definition
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
sco  Streptomyces coelicolor
Pathway
sco00740  Riboflavin metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO1440 (ribH)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     SCO1440 (ribH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMRL_synthase
Motif
Other DBs
NCBI-GeneID: 1096866
NCBI-ProteinID: NP_625721
Kitasato: SCO1440
UniProt: Q9EWJ9
Position
complement(1536089..1536574)
Genome map
AA seq 161 aa AA seqDB search
MSGKGAPELSVRNVGDLRVAVIASQWHDKVMDGLVDGALRALHELGIDEPTLLRVPGSFE
LPVVAKVLAGRGYDAIVALGVVIRGGTPHFDYVCQGVTQGLVQVSVETGVPVGFGVLTCD
TEEQALDRAGIEGSSEDKGHEAVTAAVATAATLRSVSEPWR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaagggtgcaccggaactgtccgtacgcaacgtcggagacctcagggtcgcc
gtgatcgcgtcgcagtggcacgacaaggtgatggacggactggtcgacggcgccctgcgc
gccctgcacgagctggggatcgacgagccgaccctgctcagggtccccggcagcttcgaa
ctgccggtggtcgccaaggtcctcgcgggccgcggctacgacgcgatcgtcgccctcggc
gtcgtcatccgcggcggcaccccccacttcgactacgtctgccagggcgtcacccagggc
ctggtccaggtctccgtcgagaccggcgtccccgtcggcttcggcgtcctcacctgcgac
accgaggaacaggccctggaccgggccggtatcgagggctccagcgaggacaagggccac
gaggcggtgaccgcggccgtcgccacggcggccacgctccgctcagtatccgaaccgtgg
cgctag

DBGET integrated database retrieval system