KEGG   Streptomyces coelicolor: SCO1461Help
Entry
SCO1461           CDS       T00085                                 

Gene name
guaB2, SCL6.18c
Definition
(RefSeq) inosine 5-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO1461 (guaB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1461 (guaB2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     SCO1461 (guaB2)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO1461 (guaB2)
  Exosomal proteins of breast cancer cells
   SCO1461 (guaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth Glu_synthase QRPTase_C Aldolase DUF3659
Motif
Other DBs
NCBI-GeneID: 1096887
NCBI-ProteinID: NP_625742
Kitasato: SCO1461
UniProt: Q9L0Z8
Position
complement(1558380..1559831)
Genome map
AA seq 483 aa AA seqDB search
MQHVRFLNDIQPSYDLTYDDVFMVPSRSAVGSRQGVDLGSPDGTGTTIPLVVANMTAIAG
RRMAETVARRGGLVVIPQDIPIEVVTDVVSWVKSRHHVLDTPIVLAPHQTVADALALLPK
RAHNAGVVVDEDGKPVGVVTDTDLNGVDRFTQLEEVMSKDLILIDADLDPREAFNTLDAA
NRRYAPAVDKDGRLAGILTRKGALRATLYTPAVDAQGRLRIAAAVGINGDVAGKAKQLLD
AGVDTLVIDTAHGHQESMISAVKVVRDLDPRVPIVAGNIVSAQGVRDLIEAGADIIKVGV
GPGAMCTTRMMTGVGRPQFSAVLECAAEAKKYGKHVWADGGVRHPRDVAMALAAGASNVM
VGSWFAGTYESPGDLQHDANGRAYKESFGMASARAVRNRTSEESAYDRARKALFEEGIST
SRMFLDPARPGVEDLIDAIIAGVRSSCTYAGAGSLEEFTEKAIVGIQSAAGYAEGKPLHA
SWS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgtgcgtttcctcaatgacatccagccctcgtacgacctgacgtacgacgac
gtgttcatggtgccgagccgctccgccgtcggctcccggcagggcgtggacctcggctcc
ccggacggcacgggcaccacgatcccgctggtcgtcgccaacatgaccgccatcgcgggc
cgccggatggccgagacggtggcccggcgcggcggcctcgtggtcatcccgcaggacatc
ccgatcgaggtcgtcaccgacgtcgtctcctgggtgaagagccgccaccacgtcctggac
accccgatcgtgctggccccgcaccagaccgtcgccgacgcgctggccctgctgcccaag
cgcgcgcacaacgcgggcgtcgtcgtggacgaggacggcaagccggtcggcgtggtcacc
gacaccgacctgaacggcgtggaccgcttcacccagctcgaggaggtcatgtccaaggac
ctgatcctcatcgacgccgacctggacccgcgcgaggccttcaacaccctcgacgcggcc
aaccggcgctacgcgcccgccgtggacaaggacggccgtctcgccggcatcctcacccgc
aagggcgcgctgcgcgccaccctgtacaccccggccgtcgacgcacagggcaggctccgc
atcgccgccgccgtcggcatcaacggcgacgtggccggcaaggccaagcagctcctcgac
gcgggtgtggacaccctcgtcatcgacaccgcgcacggccaccaggaatcgatgatcagc
gccgtcaaggtggtgcgcgacctcgacccgcgggtcccgatcgtcgcgggcaacatcgtc
tccgcccagggtgtgcgcgacctgatcgaggcgggcgccgacatcatcaaggtcggcgtc
ggccccggtgccatgtgcaccacccgcatgatgaccggcgtgggccggccgcagttctcc
gccgtcctggagtgcgccgccgaggcgaagaagtacggcaagcacgtgtgggccgacggc
ggcgtccgccacccgcgcgacgtggcgatggccctcgcggccggcgcctccaacgtgatg
gtcggctcctggttcgcgggcacctacgagtccccgggcgacctccagcacgacgccaac
ggccgcgcctacaaggagtccttcggcatggcctccgcgcgcgcggtgcgcaaccgcacc
tcggaggagtcggcgtacgaccgggcccgcaaggcgctgttcgaggagggcatctccacc
tcgcggatgttcctcgacccggcccggcccggcgtcgaggacctgatcgacgcgatcatc
gcgggcgtccgctcgtcctgcacctacgccggggccggctccctggaggagttcacggag
aaggccatcgtcggcatccagagcgccgccggttacgccgagggcaagccgctgcacgcc
agctggagctga

DBGET integrated database retrieval system