KEGG   Streptomyces coelicolor: SCO1464Help
Entry
SCO1464           CDS       T00085                                 

Gene name
rpe, SCL6.21c
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00040  Pentose and glucuronate interconversions
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1464 (rpe)
   00040 Pentose and glucuronate interconversions
    SCO1464 (rpe)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     SCO1464 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim OMPdecase QRPTase_C
Motif
Other DBs
NCBI-GeneID: 1096890
NCBI-ProteinID: NP_625745
Kitasato: SCO1464
UniProt: Q9L0Z5
Position
complement(1561471..1562157)
Genome map
AA seq 228 aa AA seqDB search
MAAQINPSILSADFARLADEAKAVEGADWLHVDVMDNHFVPNLTLGVPVVESLARATDTP
LDCHLMIEAPDRWAPQYVEAGAGSVTFHAEAAAAPVRLAREIRAKGARASMALKPATPVE
PYEDLLPELDMLLIMTVEPGFGGQAFLDIMLPKIRRTRELIKKHGLELWLQVDGGVSAAT
IERCADAGADVFVAGSAVYGASDPAEAVRALRTQADAATAEASWSCDH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcagatcaaccccagcatcctgtccgccgacttcgcccgcctcgcggacgag
gccaaggcggtcgagggagccgactggctccacgtcgacgtcatggacaaccacttcgtc
ccgaacctcacgctcggtgtgccggtggtcgagtccctggcccgcgcgaccgacaccccg
ctcgactgccacctgatgatcgaggcccccgaccgctgggcgccgcagtacgtggaggcg
ggcgccggttccgtcaccttccacgccgaggcggccgccgcgccggtgcggctggcccgg
gagatccgggccaagggcgcccgcgcgtccatggcgctcaagcccgcgacgccggtcgag
ccctacgaggacctgctccccgaactcgacatgctgctgatcatgacggttgaacccggc
ttcggtgggcaggcgttcctggacatcatgcttcccaagatccgccgcacccgtgagctg
atcaagaagcacggtctggagctgtggctccaggtcgacggcggtgtctcagcggccacg
atcgagcggtgcgccgacgccggagccgacgtcttcgtcgcggggtccgcggtgtacggg
gcgtccgacccggccgaggcggtacgtgcactgcgcacgcaggcagacgcggcgaccgcc
gaggcatcctggtcctgcgaccactga

DBGET integrated database retrieval system