KEGG   Streptomyces coelicolor: SCO1481Help
Entry
SCO1481           CDS       T00085                                 

Gene name
pyrF
Definition
(RefSeq) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1481 (pyrF)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     SCO1481 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-GeneID: 1096907
NCBI-ProteinID: NP_625761
Kitasato: SCO1481
UniProt: Q9KXR8
Position
complement(1582059..1582895)
Genome map
AA seq 278 aa AA seqDB search
MEPFGARLRRAMDERGPLCVGIDPHASLLAEWGLNDDVAGLERFSRTVVEAMADRVAVLK
PQSAFFERFGSRGVAVLETTVQEARAAGALVVMDAKRGDIGSTMAAYAESFLHKDAPLFS
DALTVSPYLGYGSLKPAVDLARESGAGLFVLALTSNPEGGEVQHAVRGDGRSVGATMLAH
LAAENAGEEPLGSFGAVVGATLGDLSSYDLGINGPLLAPGIGAQGATPADLPRVFGAALR
NVVPNVSRGVLRHGPDVTALRTAADRFAVEIRTAVTAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttcggtgcccggctgcgccgcgcgatggacgagcgcggccccctgtgcgtc
ggcatcgacccgcacgcctccctgctcgccgagtggggcctgaacgacgacgtggccggc
ctcgagcgcttcagccgcaccgtcgtggaggcgatggccgaccgggtcgccgtgctcaag
ccgcagagcgccttcttcgagcggttcggctcgcgcggcgtcgccgtcctggagacgacg
gtccaggaggcgcgggcggccggcgcgctggtcgtcatggacgccaagcgcggcgacatc
ggctcgaccatggccgcgtacgccgagtcgttcctgcacaaggacgcgccgctgttctcg
gacgcgctgaccgtctccccgtacctcggctacggctccctgaagccggccgtcgacctg
gcgcgcgagagcggtgcgggcctgttcgtgctggcgctgacctccaacccggagggcggc
gaggtccagcacgcggtgcggggcgacgggcgcagcgtcggggcgaccatgctggcgcac
ctggccgccgagaacgcgggggaggagccgctcggctccttcggcgcggtggtcggtgcc
acgctcggcgacctgtcctcgtacgacctgggcatcaacggtccgctgctggcgccgggc
atcggcgcccagggggccacgcccgcggatctgccgcgcgtgttcggtgcggcgctgcgc
aacgtggtgccgaacgtcagccggggtgtccttcgtcacggtcccgacgtgaccgcgttg
cggactgctgccgaccgcttcgcggtggagatccggaccgcggtcacggcgtcctga

DBGET integrated database retrieval system