KEGG   Streptomyces coelicolor: SCO1482Help
Entry
SCO1482           CDS       T00085                                 

Gene name
pyrD, SC9C5.06c
Definition
(RefSeq) dihydroorotate dehydrogenase 2
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1482 (pyrD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     SCO1482 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHO_dh DUF1484
Motif
Other DBs
NCBI-GeneID: 1096908
NCBI-ProteinID: NP_625762
Kitasato: SCO1482
UniProt: Q9KXR7
Position
complement(1582901..1584007)
Genome map
AA seq 368 aa AA seqDB search
MYKTFFKLVFSRMDPERAHHLAFRWIRLAVRVPVLRTFVAAALAPRHKELRTEALGLRMH
GPFGLAAGFDKNAVAIDGMAMLGFDHVEIGTVTGEPQPGNPKKRLFRLVADRALINRMGF
NNDGSLAVAARLASRTPVFRTVVGVNIGKTKVVPEEEAVGDYVKSAERLAPHADYLVVNV
SSPNTPGLRNLQATEALRPLLSAVREAADRAVTARRVPLLVKIAPDLADEDVDAVADLAV
ELGLDGIIATNTTIAREGLGLTSSPALVGETGGLSGAPLKARSLEVLRRLYARVGDRITL
VGVGGVETAEDAWERILAGATLVQGYSAFIYEGPFWGRAMHKGLAARLRQSPYATLADAV
GADVRKHS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaccttcttcaagctcgtcttctcccgcatggacccggagcgggcccaccac
ctcgccttccgctggatccgcctcgccgtccgcgtccccgtcctgcgcaccttcgtcgcc
gccgcgctcgcgccccgccacaaggaactgcgcaccgaggccctcggcctgcgcatgcac
ggccccttcggcctcgccgccgggttcgacaagaacgcggtcgccatcgacggcatggcg
atgctcggcttcgaccacgtcgagatcggcaccgtgacgggggagccgcagcccggcaac
cccaagaagcggctgttccgcctggtggccgaccgtgcgctgatcaaccgcatgggcttc
aacaacgacggctcgctggccgtcgcggcccgcctggcctcccgcacgcccgtcttccgc
accgtcgtcggcgtcaacatcggcaagacgaaggtcgtccccgaggaggaggccgtcggc
gactacgtgaagtccgccgagcggctggccccgcacgccgactacctggtcgtcaacgtc
tcctcgcccaacacgcccggcctgcgcaacctccaggccaccgaggcgctgcgcccgctg
ctgagcgcggtccgcgaggccgccgaccgcgcggtgaccgcccggcgtgtcccgctgctg
gtcaagatcgcgccggacctcgccgacgaggacgtggacgcggtcgccgacctggccgtg
gagctgggcctggacggcatcatcgccaccaacaccaccatcgcgcgcgagggactcggc
ctgacctcctcgcccgccctcgtcggggagaccggcggtctgtccggggccccgctcaag
gcacgctccctggaggtgctgcgccgcctctacgcgcgcgtgggcgaccggatcaccctg
gtcggtgtcggcggggtcgagacggccgaggacgcctgggagcgcatcctggccggtgcc
accctggtccagggctacagcgcgttcatctacgaaggccccttctggggccgcgccatg
cacaagggactcgccgcccgcctgcggcagagcccgtacgccaccctcgccgacgcggtc
ggcgccgacgtaaggaagcactcatga

DBGET integrated database retrieval system