KEGG   Streptomyces coelicolor: SCO1487Help
Entry
SCO1487           CDS       T00085                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1487 (pyrB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1487 (pyrB)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SCO1487 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 1096913
NCBI-ProteinID: NP_625767
Kitasato: SCO1487
UniProt: Q9KXR2
Position
complement(1590407..1591387)
Genome map
AA seq 326 aa AA seqDB search
MQRHLISAADLTRDDAVLILDTAEEMARVADRPIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAEKRLSADVINFTAKGSSVSKGESLKDTAQTLEAMGVDAVVIRHSASGAPYRLATSGW
IDAAVVNAGDGTHQHPTQALLDAFTMRRRLVGRDAGLGKDLDGRRITLVGDILHSRVARS
NVDLLHTLGAEVTLVAPPTLLPVGVETWPCEVSYDLDSTLPKSDAVMLLRVQRERMNAAF
FPTEREYSRRYGLDGDRMAKMPDHAIVMHPGPMVRGMEITAEVADSDRCTVVEQVTNGVS
IRMAVLYLLLGGNEPAVSHARPIEEK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcatctcatctcggccgccgacctcacccgcgacgacgccgtcctgatcctc
gacaccgccgaggagatggcccgggtcgcggaccggccgatcaagaaactgccgaccctg
cgcggccgcaccgtcgtcaacctcttcttcgaggactccacccggacccggatctccttc
gaggccgccgagaagcggctgtccgcggacgtcatcaacttcaccgccaagggatccagc
gtctccaagggcgagtccctcaaggacaccgcccagaccctggaggcgatgggcgtcgac
gccgtcgtcatccggcacagcgcctccggcgccccctaccgcctggccacctccggctgg
atcgacgccgccgtggtcaacgccggggacggcacccaccagcaccccacccaggccctg
ctcgacgccttcaccatgcgccgccgcctggtcggccgcgacgccgggctcggcaaggac
ctggacggccgccggatcaccctcgtcggcgacatcctgcacagccgcgtcgcccgctcc
aacgtcgacctgctgcacaccctcggcgccgaggtcaccctcgtcgccccgcccaccctg
ctgccggtcggcgtcgagacctggccctgcgaggtctcctacgacctcgactccacgctg
cccaagtccgacgcggtgatgctgctgcgcgtgcagcgcgagcggatgaacgccgcgttc
ttccccaccgagcgcgagtactcccgccgctacggcctcgacggcgaccgcatggcgaag
atgcccgaccacgccatcgtgatgcaccccggccccatggtccgcggcatggagatcacc
gccgaggtcgccgactccgaccgctgcaccgtcgtcgagcaggtcaccaacggcgtctcc
atccggatggccgtcctctacctgctgctcggcggcaacgagcccgccgtgtcccacgcc
cgccccatcgaggagaagtaa

DBGET integrated database retrieval system