KEGG   Streptomyces coelicolor: SCO1495Help
Entry
SCO1495           CDS       T00085                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1495 (aroK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SCO1495 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA AAA_33 AAA_16 Cytidylate_kin AAA_22 dNK AAA_28 AAA_5 Thymidylate_kin RuvB_N ABC_tran RNA_helicase Rad17 Cytidylate_kin2 RsgA_GTPase TsaE CoaE
Motif
Other DBs
NCBI-GeneID: 1096921
NCBI-ProteinID: NP_625775
Kitasato: SCO1495
UniProt: Q9KXQ5
Position
complement(1597578..1598093)
Genome map
AA seq 171 aa AA seqDB search
MSAPLIVLVGPMGVGKSTVGQLLAERLGTGYRDTDEDIVTAQGRAIAEIFVDEGEAAFRT
LEKEAVRTALAEHEGVLALGGGAILDADTRALLAGQRVVYLSMDVEEAVKRTGLNAARPL
LAVNPRKQWRELMEARRHLYEDVATAVVATDGRTPEEVTQAALDAVELKEA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccgctgatcgtcctggtcgggccgatgggggtcggcaagtccaccgtcggg
cagctgctcgccgagcggctgggcacgggataccgggacacggacgaggacatcgtcacc
gcccaggggcgggccatcgccgaaatcttcgtggacgagggcgaggccgccttccggacc
ctggagaaggaggccgtgcggaccgcgctcgccgagcacgagggcgtcctcgccctcggc
ggtggcgcgatcctggacgcggacacccgcgcgctgctcgccgggcagcgggtcgtctac
ctctcgatggacgtcgaggaggccgtcaagcgcaccggcctgaacgcggcgcgtccgctg
ctggcggtcaacccgcgcaaacagtggcgcgaactgatggaggcccgtcggcacctctac
gaggacgtcgccacggccgtcgtggccacggacggtcgtacgccggaagaagtcacccaa
gccgccctggacgcagtggagttgaaagaagcatga

DBGET integrated database retrieval system