KEGG   Streptomyces coelicolor: SCO1496Help
Entry
SCO1496           CDS       T00085                                 

Gene name
aroF, SC9C5.20c
Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1496 (aroF)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     SCO1496 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-GeneID: 1096922
NCBI-ProteinID: NP_625776
Kitasato: SCO1496
UniProt: Q9KXQ4
Position
complement(1598090..1599274)
Genome map
AA seq 394 aa AA seqDB search
MSRLRWLTAGESHGPALVATLEGLPAGVPITTEMVADHLARRRLGYGRGARMKFERDEVT
FLGGVRHGLTMGSPVAVMVGNTEWPKWEQVMAADPVDPEVLAGLARNAPLTRPRPGHADL
AGMQKYGFDEARPILERASARETAARVALGAVARSYLKETAGVEIVSHVVELASAKAPHG
VYPTPADVERLDADPVRCLDADASKAMVAEIDQAHKDGDTLGGVVEVLAYGVPVGLGSHV
HWDRKLDARLAGALMGIQAIKGVEIGDGFELARVPGSRAHDEIVGTPDGIRRVSGRSGGT
EGGLTTGELLRVRAAMKPIATVPRALKTVDVATGEAAQAHHQRSDVSAVPAAGIVAEAMV
ALVLADAVAEKFGGDSVTETRRNVRSYLDNLDIR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaggttgcgctggctgaccgcgggggagtcccacggtcccgcactcgtcgcgacg
ctggaggggctgcccgccggtgtgccgatcaccacggagatggtggcggaccacctggcc
aggcggcgactcggttacggccgcggtgcgcggatgaagttcgagcgcgacgaggtgacc
ttcctcggcggcgtccggcacgggctgaccatgggttctccggtcgccgtgatggtcggc
aacaccgagtggcccaagtgggagcaggtcatggcggccgacccggtggacccggaggtg
ctggccggcctcgcgcgcaacgccccgctgaccaggccgcgccccggccacgcggacctc
gccgggatgcagaagtacggcttcgacgaggcccggccgatcctcgaacgcgcctccgcc
cgtgagacggcggcccgcgtcgccctgggcgcggtggcccggtcgtacttgaaggagacg
gccggcgtcgagatcgtcagccatgtcgtcgagctggcctcggcgaaggcgccccacggg
gtctacccgacgccggccgacgtggagcggctggacgccgacccggtgcgctgcctggac
gcggacgcgtcgaaggcgatggtcgccgagatcgaccaggcccacaaggacggcgacacc
ctcggcggcgtcgtggaggtcctcgcctacggggtgccggtgggcctcggctcgcacgtc
cactgggaccgcaagctcgacgcgcggctcgcgggcgccctgatgggcatccaggcgatc
aagggcgtcgagatcggcgacggcttcgagctggcccgggtgcccggttcccgggcgcac
gacgagatcgtggggacgccggacggcatccgccgcgtctcgggccgttccggcggcacc
gagggcgggctcaccaccggtgagctgctgcgggtgcgcgcggcgatgaagccgatcgcg
acggtgccgcgcgccctgaagaccgtggacgtggccaccggcgaggccgcgcaggcgcac
caccagcgctccgacgtgtccgcggtgccggccgccgggatcgtcgcggaggcgatggtg
gcgctggtcctcgcggacgcggtggcggagaagttcggcggcgacagcgtgaccgagacc
cgccgcaacgtgcggtcctacctcgacaacctggacatccgatga

DBGET integrated database retrieval system