KEGG   Streptomyces coelicolor: SCO1498Help
Entry
SCO1498           CDS       T00085                                 

Gene name
aroE
Definition
(RefSeq) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1498 (aroE)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     SCO1498 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N SDH_C OCD_Mu_crystall Shikimate_DH F420_oxidored
Motif
Other DBs
NCBI-GeneID: 1096924
NCBI-ProteinID: NP_625778
Kitasato: SCO1498
UniProt: Q9KXQ2
Position
complement(1599894..1600733)
Genome map
AA seq 279 aa AA seqDB search
MPAPATDRRRAAVLGSPIAHSLSPVLHRAAYAELGLADWTYDHFDVDEAALPGFLEGLGP
EWAGLSLTMPLKRAVIPLLDSVSETAASVDAVNTVVLTEDGRRTGDNTDIPGIAAALREH
GIEKVESAAILGAGATASSALAALARICTGEVTVHVRSAARAAEMRGWAERLGVDVRLAD
WADAAEALRAPLVVATTPAGATDALAAAVPEMPTTLFDVLYDPWPTALAARWSAHGGAVV
SGLDLLLHQAVLQVEQMTGRAPAPLAAMRKAGEHALADR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccggcaactgaccggcgccgggccgccgtactcggctccccgatcgcccac
tcgctctccccggtgctgcaccgcgccgcctacgcggagctgggcctcgcggactggacg
tacgaccacttcgacgtggacgaggcggccctgccgggcttcctcgagggactcgggccc
gagtgggcggggctgtcgctgaccatgccgctcaagcgggcggtgatcccgctgctcgac
tcggtcagcgagacggcggcctccgtggacgcggtgaacaccgtcgtcctcaccgaggac
ggccgcaggaccggcgacaacaccgacatccccggcatcgccgccgccctgcgcgagcac
ggcatcgagaaggtcgagtccgccgcgatcctcggcgccggcgccaccgcgtcctccgcg
ctcgccgcgctggcccggatctgcaccggcgaggtcacggtccacgtacgcagcgcggcc
cgcgccgccgagatgcggggctgggcggaacggctcggcgtcgacgtgcgcctcgccgac
tgggcggacgccgcggaggcactgcgcgccccgctggtcgtggccaccaccccggccggt
gccaccgacgcgctcgcggccgccgtccccgagatgcccaccacgctcttcgacgtgctc
tacgacccctggcccaccgcgctcgccgcccgctggtcggcgcacggcggtgccgtcgtc
agcggcctggacctgctgctccaccaggccgtgctccaggtggagcagatgaccggacgg
gcgccggcaccgctggccgccatgcgaaaagcgggggagcacgcgctcgcggatcgctag

DBGET integrated database retrieval system