KEGG   Streptomyces coelicolor: SCO1546Help
Entry
SCO1546           CDS       T00085                                 

Gene name
SCL11.02c
Definition
(RefSeq) 4-amino-4-deoxychorismate lyase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00280  Valine, leucine and isoleucine degradation
sco00290  Valine, leucine and isoleucine biosynthesis
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1546 (SCL11.02c)
   00280 Valine, leucine and isoleucine degradation
    SCO1546 (SCL11.02c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO1546 (SCL11.02c)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO1546 (SCL11.02c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO1546 (SCL11.02c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SCO1546 (SCL11.02c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class IV
   SCO1546 (SCL11.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 1096972
NCBI-ProteinID: NP_625824
Kitasato: SCO1546
UniProt: Q9L1D6
Position
complement(1654295..1655116)
Genome map
AA seq 273 aa AA seqDB search
MKIWLDGGLQDIGSARVSVLDHGLTVGDGIFETVKAVDGRPFALTRHLDRLTRSARGLGL
PAPDHDEVRRACAAVLEANPMPLGRLRVTYTGGHGPLGSDRGEHGPTLVVALGETGRRPD
STAVITVPWTRNERGALTGLKTTSYAENVVALARARERGATEALFGNTVGRLCEGTGSNV
FVVLDGEIHTPPVASGCLAGITRALAAEWTGARETDLPLDVLGRADEVFLTSTLRDVQAV
HRIDDRELPGAPGPVTAKAMRIFQERSGDDLDP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctggctcgacggcgggttgcaggacatcggttccgcccgcgtctccgtcctc
gatcacggactgaccgtgggcgacggcatcttcgagaccgtgaaggcggtggacggccgg
ccgttcgcgttgacccggcacctggaccggctgacccgctcggcccgcggcctcggcctg
cccgcccccgaccacgacgaggtccgccgcgcctgtgccgccgtgctggaggccaacccg
atgccgctgggccggctgcgcgtcacctacaccggcggccacggcccgctcggctccgac
cgcggcgagcacggcccgaccctcgtcgtcgccctcggcgagaccggccgccgccccgac
tccaccgccgtgatcacggtgccctggacccgcaacgaacgcggcgcgctcaccggcctg
aagaccacctcctacgccgagaacgtcgtcgccctggcccgggcccgcgaacggggcgcc
accgaggcgctgttcggcaacacggtgggccggctctgcgagggcaccgggtcgaacgtc
ttcgtcgtcctcgacggcgagatccacaccccgccggtcgcctccggctgcctcgccggg
atcacccgcgccctggccgccgagtggaccggtgcccgcgagaccgacctcccgctggac
gtcctggggcgcgccgacgaggtcttcctgacctcgacgctgcgggacgtacaggccgtg
caccggatcgacgaccgcgaactgccgggcgccccgggaccggtgacggccaaggccatg
cggatcttccaggagcggtccggggacgacctggatccgtga

DBGET integrated database retrieval system