KEGG   Streptomyces coelicolor: SCO1560Help
Entry
SCO1560           CDS       T00085                                 

Gene name
SCL11.16c
Definition
(RefSeq) phosphatase
  KO
K19270  sugar-phosphatase [EC:3.1.3.23]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO1560 (SCL11.16c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.23  sugar-phosphatase
     SCO1560 (SCL11.16c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 1096991
NCBI-ProteinID: NP_625838
Kitasato: SCO1560
UniProt: Q9L1C2
Position
complement(1672166..1672816)
Genome map
AA seq 216 aa AA seqDB search
MKLHAQALLFDNDGTLVSSLESVRRCWTRWAVEYGITAEQFGQVELHGRPAAEIAADLLP
TARVAEAVARIEQLEVEDVPGGGVRLLPGTRDFLDALPADRWAVVTSATRRLAEARLDAV
GILPKTLVAADDITRGKPDPEPYLLGARALGVDPADCVVFEDAPAGLQAGRAAGMRTVAL
ATTHRADELNADLVVTDLSALSALATEGGVEITVRG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgcacaagccctcctgttcgacaacgacggcaccctcgtctcctccctg
gaatccgtccgccgctgctggacgcgctgggccgtcgagtacgggatcaccgccgagcag
ttcgggcaggtggaactgcacggacggccggccgccgagatagccgccgacctgctgccc
accgcgagggtcgccgaggcggtcgcgcggatcgaacagctggaggtcgaggacgtgccg
ggcgggggcgtgcgcctgctgcccggcacccgcgacttcctcgacgcgctcccggccgac
cgctgggccgtcgtcacctccgccacccgccgcctggccgaggcccgcctcgacgccgtc
ggcatcctgcccaagaccctcgtggccgccgatgacatcacccgcggcaagcccgacccc
gagccctatctgctcggcgcccgcgccctgggcgtcgacccggccgactgcgtcgtcttc
gaggacgcccccgccgggctccaggccggccgggccgccgggatgcggaccgtggcgttg
gccacaacacaccgagccgacgaactcaacgccgacctcgtcgtcaccgacctctcggcc
ttgtcggcactggccaccgagggcggagtcgagatcaccgtccggggctga

DBGET integrated database retrieval system