KEGG   Streptomyces coelicolor: SCO1570Help
Entry
SCO1570           CDS       T00085                                 

Gene name
argH, SCL24.06c
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1570 (argH)
   00220 Arginine biosynthesis
    SCO1570 (argH)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SCO1570 (argH)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1570 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 1097001
NCBI-ProteinID: NP_625847
Kitasato: SCO1570
UniProt: Q9L1B1
Position
complement(1680432..1681859)
Genome map
AA seq 475 aa AA seqDB search
MSSNSGDVRLWGGRFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLHAAGLLTED
ELTRMIAGLDRLEADVADGSFTGTIADEDVHTALERGLLERLGPDLGGKLRAGRSRNDQV
ATLFRMYLRDHARTVGSLIADLQDALVGLAEAHPDVAMPGRTHLQHAQPVLFAHHVLAHA
QALGRDAERLRQWDARTAVSPYGSGALAGSSLGLDPEAVARDLGFEHGSVGNSIDGTASR
DFVAEFAFITAMIGVNVSRIAEEIIIWNTKEFSFVTLHDAFSTGSSIMPQKKNPDIAELA
RGKSGRLIGNLTGLMATLKALPLAYNRDLQEDKEPVFDSIDQLEVLLPAFTGMMATLTVH
RERMEELAPAGFSLATDIAEWLVKQGVPFRVAHEVAGECVKVAEADGKELDELTDEQFAK
ISEHLTPEVRTVLNVPGALASRDGRGGTAPSAVAVQLAEVKADVAAQHAWADAKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcaacagcggtgacgtccggctctggggcggccgtttcgccgacggtcccgcc
gaggccctggcgaagctgtccgcgtccgtccacttcgactggcggctcgcgccctacgac
atcgccggttcgcgcgcccacgcgcgcgtgctgcacgcggcggggctgctcaccgaggac
gagctgacccggatgatcgccggactggaccggctggaggcggacgtcgccgacggctcc
ttcaccggcaccatcgccgacgaggacgtccacacggccctggagcgcgggctgctggag
cgcctcggccccgacctcggcggcaagctgcgcgccgggcgctcccgcaacgaccaggtg
gcgaccctcttccggatgtacctgcgcgaccacgcccggaccgtcggctcgctgatcgcc
gacctccaggacgcactggtcggcctcgccgaggcccacccggacgtggccatgcccggc
cgcacccacctccagcacgcccagccggtgctcttcgcccaccacgtgctcgcccacgcc
caggcgctgggccgggacgcggagcggctgcgccagtgggacgcgcgcaccgccgtctcc
ccgtacggctcgggcgcgctcgcgggcagcagcctcggcctggacccggaggccgtcgcc
cgtgacctgggcttcgagcacggcagcgtcggcaactccatcgacgggacggcctcgcgc
gacttcgtcgccgagttcgccttcatcaccgcgatgatcggcgtcaacgtctcccggatc
gccgaggagatcatcatctggaacacgaaggagttctccttcgtcaccctccacgacgcc
ttctccaccggctcctcgatcatgccgcagaagaagaaccccgacatcgccgagctggcc
cgcggcaagtccgggaggctgatcggcaacctgaccggcctgatggcgaccctcaaggcg
ctcccgctcgcgtacaaccgcgacctccaggaggacaaggagccggtcttcgactccatc
gaccagctggaggtcctgctccccgccttcaccggcatgatggccaccctcaccgtgcac
cgcgagcggatggaggagctggccccggccgggttctcgctcgccaccgacatcgccgag
tggctggtcaagcagggtgtgccgttccgcgtcgcgcacgaggtggccggcgagtgcgtc
aaggtcgccgaggccgacggcaaggagctggacgagctgaccgacgagcagttcgccaag
atctccgagcacctcacccccgaggtgcgcaccgtcctcaacgtccccggcgccctggcc
tcccgcgacggccgcggcggcacggcgcccagcgcggtcgccgtccagctcgccgaggtc
aaggcggacgtggcggcccagcacgcctgggcggacgccaagaagtag

DBGET integrated database retrieval system