KEGG   Streptomyces coelicolor: SCO1577Help
Entry
SCO1577           CDS       T00085                                 

Gene name
argD
Definition
(RefSeq) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sco_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO1577 (argD)
   00220 Arginine biosynthesis
    SCO1577 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO1577 (argD)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     SCO1577 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     SCO1577 (argD)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO1577 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1097008
NCBI-ProteinID: NP_625854
Kitasato: SCO1577
UniProt: Q9L1A4
Position
complement(1687163..1688371)
Genome map
AA seq 402 aa AA seqDB search
MSNEELTERWQGTLMNNYGTPRLPLVRGEGARLWDADGKEYLDFVGGIAVNALGHAHPAV
VDAVSRQIASLGHVSNLFIAEPPVALAERLLQHFGRDGKVYFCNSGAEANEGAFKIGRLT
GRPHMVATRGGFHGRTMGALALTGQPGKQEPFLPLPGDVTHVPYGDPQALAAAVTEETAL
VIIEPIQGENGVVVPPPGYLKAARAITAATGALLVLDEVQTGVGRTGHWFEYQAHEGVLP
DVVTLAKGLGGGLPLGATVAFGRAADLLQPGHHGTTFGGNPVACAAGLAVLDTIADEGLL
DNVKRQSETLRGGVEALGHPLVAHVRGAGLLLGIVLTEPLAAQVQQAAQDAGILVNAPAP
DVVRLMPALNLGDDVVEAFLGALPGILDQAAETAHGDGRSGE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaagagctgaccgagcggtggcagggcaccctcatgaacaactacggcacg
ccccgcctgcccctggtgcgcggcgagggcgcccggctctgggacgccgacggcaaggag
tacctggacttcgtcggcggtatcgcggtcaacgcgctcgggcacgcccacccggcggtg
gtggacgccgtgagccggcagatcgcctccctcggccacgtctccaacctcttcatcgcg
gagccgcccgtcgccctcgccgaacggctgctccagcacttcggccgcgacggcaaggtc
tacttctgcaactccggcgccgaggccaacgagggcgccttcaagatcggccggctgacc
ggccggccgcacatggtcgccacccgcggcggcttccacggccgcaccatgggcgccctg
gcgctgaccggccagcccggcaagcaggaaccgttcctgccgctgcccggcgacgtcacg
cacgtgccgtacggcgatccgcaggcgctggccgcggcggtcaccgaggagacggcgctg
gtgatcatcgagccgatccagggcgagaacggcgtcgtcgtcccgccccccggctacctg
aaggcggcccgcgccatcaccgccgccaccggcgcgctgctcgtcctggacgaggtgcag
accggcgtcggccggaccgggcactggttcgagtaccaggcccacgagggcgtcctgccg
gacgtcgtcaccctcgccaagggcctcggcggcggactgccgctcggcgcgacggtcgcc
ttcggccgcgccgccgacctgctccagcccggccaccacggcaccaccttcggcggcaac
ccggtcgcctgcgccgccggactcgccgtgctggacaccatcgccgacgagggactgctc
gacaacgtcaagcggcagagcgagacgctgcgcggcggggtcgaggccctcggccacccg
ctcgtcgcccacgtccggggcgccggactgctcctgggtatcgtgctcaccgagccgctc
gccgcccaggtgcagcaggcggctcaggacgccggaatcctggtgaacgcgcccgcaccc
gatgtcgtacggctgatgcccgcgctgaacctcggcgacgacgtggtggaggcgttcctc
ggggcgctgcccggcatccttgaccaggccgccgagacggcccacggggacggacgatcc
ggagaatga

DBGET integrated database retrieval system