KEGG   Streptomyces coelicolor: SCO1580Help
Entry
SCO1580           CDS       T00085                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO1580 (argC)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     SCO1580 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC
Motif
Other DBs
NCBI-GeneID: 1097011
NCBI-ProteinID: NP_625856
Kitasato: SCO1580
UniProt: P54895
Position
complement(1690433..1691461)
Genome map
AA seq 342 aa AA seqDB search
MAVRAAVAGASGYAGGELLRLLLTHPEVEIGALTGNSNAGQRLGALQPHLLPLADRVLEA
TTPEVLGGHDVVFLALPHGQSAAVAEQLGPDVLVVDMGADFRLKDAGDWERFYGSPHAGT
WPYGLPELPGARAALEGSKRIAVPGCYPTAVSLALFPAYAASLAEPEAVIVAASGTSGAG
KAAKPHLLGSEVMGSMSPYGVGGGHRHTPEMIQNLGAVAGEPVTVSFTPTLAPMPRGILA
TCTAKAKPGVTAESVRAAYEKALADEPFVHLLPEGQWPATASVYGSNAVQVQVAHDAAAG
RIIAISAIDNLAKGTAGGAVQSMNLALGLDETTGLTTIGVAP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacgtgcggcggtggccggagcgagtgggtatgcgggcggtgagctgctgcgg
ctgctcctgacccatcccgaggtcgagatcggcgccctgaccggcaactccaacgcgggt
cagcggctgggtgcccttcagccgcatctgctgccgctggccgaccgggtgctggaggcg
accacccccgaggtgctcggcggtcacgacgtcgtcttcctcgcgctgccgcacgggcag
tccgccgccgtcgccgagcagctcggaccggacgtcctcgtcgtcgacatgggcgccgac
ttccggctgaaggacgccggtgactgggagcggttctacggctccccgcacgccggcacc
tggccctacggcctccccgaacttccgggtgcccgcgccgcgctggaggggtccaagcgc
atcgcggtgcccggttgctaccccacggccgtctccctggccctcttcccggcgtacgcc
gcgtcgctggccgagcccgaggccgtgatcgtcgccgcctccggcacctccggcgcgggc
aaggcggccaagccgcacctgctgggcagcgaggtcatgggctccatgtcgccgtacggc
gtcggcggcggccaccggcacacccccgagatgatccagaacctcggcgcggtcgcgggc
gagccggtcaccgtctccttcactccgaccctcgcgccgatgccgcgcggcatcctcgcc
acctgcaccgcgaaggcgaagcccggggtcaccgccgagtcggtgcgcgccgcctacgag
aaggccctcgccgacgaaccgttcgtgcacctgctgcccgagggccagtggcccgcgacc
gcctccgtgtacggctccaacgccgtccaggtacaggtcgcccacgacgccgccgccggc
cgcatcatcgccatcagcgccatcgacaacctggccaagggcaccgcgggcggtgccgtc
cagagcatgaacctcgccctcggtctcgacgagaccaccggactgacgacgatcggagtt
gcgccgtga

DBGET integrated database retrieval system