KEGG   Streptomyces coelicolor: SCO1591Help
Entry
SCO1591           CDS       T00085                                 

Gene name
SCI35.13
Definition
(RefSeq) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sco  Streptomyces coelicolor
Pathway
sco00360  Phenylalanine metabolism
sco00362  Benzoate degradation
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO1591 (SCI35.13)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO1591 (SCI35.13)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO1591 (SCI35.13)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SCO1591 (SCI35.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C Sacchrp_dh_NADP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 1097022
NCBI-ProteinID: NP_625867
Kitasato: SCO1591
UniProt: O88051
Position
1700944..1701855
Genome map
AA seq 303 aa AA seqDB search
MPATSRGVSERDDVTGISGDIARVGVVGCGQMGAGIAEVCARSGLEVMVAETTGEALEIG
RTRLYNSLAKAAERGKMTEEERDATQARLSFTTDLGEFADRDLVIEAVVENEQVKTEIFQ
VLDQVVTRPDAILASNTSSIPLVKLAVATSRPDHVIGIHFFNPAPVQQLVELIPALTTSE
GTLSRAQLFTEKVLGKHAIRAQDRSGFVVNALLIPYLLSAIRMFESGIASREDIDNGMEM
GCAHPMGPLKLADLIGLDTVASVAYSMYEEYKEPLYAAPPLLQRMVDAGRLGRKSGSGFY
AYG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgaccagccgtggagtcagcgaaagggacgatgtgaccggcatctcgggagat
atcgcacgtgtcggcgtggtcggctgcggtcagatgggggcgggcatcgccgaggtgtgc
gcccgctcgggtctggaggtgatggtcgccgagaccaccggcgaggctctggagatcggc
cgcacccggctgtacaactcgctggccaaggcggccgagcgcggcaagatgaccgaggag
gagcgggacgcgacgcaggcgcgcctcagcttcaccaccgacctcggcgagttcgccgac
cgcgatctggtgatcgaggccgtcgtcgagaacgagcaggtcaagaccgagatcttccag
gtgctcgatcaggtcgtgacccggccggacgcgatcctggcctccaacacctcctccatc
ccgctggtgaagctggcggtcgccacctcgcggcccgaccacgtcatcggcatccacttc
ttcaacccggccccggtgcagcagctcgtcgagctgatcccggcgctgaccacctccgag
ggcacgctcagccgggcccagctgttcaccgagaaggtgctcggcaagcacgcgatccgc
gcccaggaccgctccggcttcgtggtcaacgcgctgctgatcccgtacctgctctccgcg
atccggatgttcgagtcgggcatcgccagccgcgaggacatcgacaacggcatggagatg
ggctgcgcccacccgatgggcccgctgaagctggccgacctgatcggcctggacacggtc
gcctcggtggcgtactcgatgtacgaggagtacaaggagccgctgtacgccgctcccccg
ctgctccagcgcatggtcgacgcgggccgcctcggccgcaagagcggctctggcttctac
gcctacggctga

DBGET integrated database retrieval system