KEGG   Streptomyces coelicolor: SCO1612Help
Entry
SCO1612           CDS       T00085                                 

Gene name
SCI35.34c
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00146  phenylacetaldehyde dehydrogenase [EC:1.2.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
sco00360  Phenylalanine metabolism
sco00643  Styrene degradation
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO1612 (SCI35.34c)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SCO1612 (SCI35.34c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.39  phenylacetaldehyde dehydrogenase
     SCO1612 (SCI35.34c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1097043
NCBI-ProteinID: NP_625888
Kitasato: SCO1612
UniProt: O88069
Position
complement(1723278..1724729)
Genome map
AA seq 483 aa AA seqDB search
MRHRLSELSELSDLSEPSERLPDELRVLNPATEEVVATVPAASAADVDAAVARAARAQTA
WAALAPGDRARLLRRFAVTVDEHLEELARLEVRQAGHLLGNARWEAGNVRDLLDYAAGGV
ERLTGRQIPVAGGLDVTLLEPLGVVGVIAPWNFPMPIAAWATAPALAAGNAVLLKPAETT
PLTALRLAELALVAGLPEDLFQVLPGHGPVAGDALVEHPDVAKIVFTGSTAVGRQVAAKG
AALLKPVTLELGGKSPNIVFADADVEAAAAATPMSFLDNSGQDCCARTRILVQRSVHDRF
LELLAPAIEAVRVGDPADESTEMGPLISRAQLERVRSHVPADAAGIRGRAPRGGPGFWFP
PTVLTGVDAHARVAVEEVFGPVAVVLPFDDEADAVRLANATDYGLAGSLWTRDVGRALRV
SGAVRAGNLSVNSHASVRYWTPFGGFKQSGIGRELGPDALTAFTETKNVFFSTTPSSTEG
PAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaccggttgtccgagctgtccgagctgtctgacctctccgagccgtccgagagg
ctccccgacgagctacgtgtcctgaaccccgccaccgaagaggtcgtcgccaccgtcccc
gccgcctccgcggccgacgtggacgccgccgtcgcccgcgccgcacgggcgcagaccgcc
tgggccgccctcgcccccggcgaccgggcccggctgctgcgccgcttcgccgtcaccgtc
gacgagcacctggaggagctggcccgtctggaggtccgccaggccgggcacctcctcggc
aacgcccgctgggaggccggcaacgtccgcgacctgctcgactacgccgccgggggagtc
gagcggctcaccggacgccagatcccggtggccggcggcctggacgtcacgctcctcgaa
ccactcggcgtcgtgggcgtcatcgccccctggaacttcccgatgccgatcgcggcctgg
gccacggcacccgcgctcgcggcgggcaacgcggtcctcctcaagcccgccgagacgacc
ccgctcaccgcgctccgcctggccgaactcgccctggtcgcaggccttcccgaggacctg
ttccaggtgctgcccgggcacgggccggtcgcgggcgacgcgctcgtcgaacacccggac
gtcgccaagatcgtcttcaccgggtccaccgccgtgggccggcaggtggccgccaagggc
gccgccctcctcaaaccggtcaccctcgaactcggcggcaagagccccaacatcgtcttc
gccgacgcggacgtcgaggccgccgcggccgcgacgcccatgtccttcctcgacaacagc
ggccaggactgctgcgcccgcacccgcatcctcgtccagcggtccgtgcacgaccgcttc
ctcgaactcctcgcccccgcgatcgaggccgtccgggtcggcgatccggccgacgagagc
accgagatgggcccgctgatctcccgcgcccaactggagcgcgtccgctcccacgtcccc
gcggacgccgccggcatccgcggcagggcgccccggggcggccccgggttctggttcccg
ccgaccgtcctcaccggcgtcgacgcgcacgcgcgcgtggccgtcgaggaggtcttcggg
cccgtcgccgtcgtcctgcccttcgacgacgaggccgacgcggtccgcctggccaacgcc
accgactacgggctggccggctccctgtggacccgggacgtcggccgcgccctgcgcgtg
tcgggcgcggtgcgcgccgggaacctgtccgtcaactcccacgccagtgtccgctactgg
acacccttcggcgggttcaagcagtccggcatcggccgcgagctgggcccggacgcgctg
accgcgttcaccgagaccaagaacgtcttcttcagcaccaccccatcgagcacggagggc
cccgcacagtga

DBGET integrated database retrieval system