KEGG   Streptomyces coelicolor: SCO1613Help
Entry
SCO1613           CDS       T00085                                 

Gene name
SCI35.35c
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00910  Nitrogen metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO1613 (SCI35.35c)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SCO1613 (SCI35.35c)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1613 (SCI35.35c)
   00220 Arginine biosynthesis
    SCO1613 (SCI35.35c)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO1613 (SCI35.35c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1613 (SCI35.35c)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SCO1613 (SCI35.35c)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1613 (SCI35.35c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Motif
Other DBs
NCBI-GeneID: 1097044
NCBI-ProteinID: NP_625889
Kitasato: SCO1613
UniProt: O88070
Position
complement(1724726..1726114)
Genome map
AA seq 462 aa AA seqDB search
MSPGQKEALPVADRTPPLGVEELHALVAAGDIDTVVLAFPDMQGRLQGKRFAARFFLDEV
LEHGTEGCNYLLAVDADMNTVDGYAMSSWDRGYGDFAMRADPATLRRLPWNEGTAMAVAD
LAWEDGSPVLAAPRQILRRQLERLAGHGYTAQVGTELEFIVFRDTYEHAWDANYRGLTPA
NQYNVDYSVLGTGRVEPLLRRIRNEMAGAGLTVESAKGECNPGQHEIAFRYDEALVTCDQ
HAVYKTGAKEIAAQEGMSLTFMAKYNELEGNSCHIHLSLADADGRNAMAEGGGMSDVMRH
FLAGQLVALREFSLLYAPHINSYKRFQPGSFAPTAVAWGHDNRTCALRVVGHGRSLRFEN
RLPGGDVNPYLAVAGLVAAGLHGIEQRLELPEPCPGNAYTADFAHVPTTLREAAELWENS
TLAKAAFGDEVVAHYRNMARVELDAFDAAVTDWELRRSFERM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccggccagaaggaggctctccccgtggcagaccgcacacccccgctcggggtc
gaggaactgcacgccctcgtcgccgccggtgacatcgacaccgtcgtcctcgccttcccc
gacatgcagggccgcctccagggcaagcggttcgccgcccggttcttcctcgatgaggtc
ctggaacacggcaccgagggctgcaactacctcctcgccgtggacgccgacatgaacacc
gtcgacggctacgccatgtcctcctgggaccgcggctacggcgacttcgccatgcgcgcc
gacccggccaccctgcgccggctcccctggaacgagggcaccgcgatggccgtcgccgac
ctcgcctgggaggacggctccccggtgctcgccgcgccccgccagatcctgcgccgccag
ctggagcggctcgccggacacgggtacaccgcacaggtcggcaccgagctggagttcatc
gtcttccgggacacctacgaacacgcctgggacgcgaactaccgcggcctgaccccggcc
aaccagtacaacgtcgactactccgtcctcggcaccggccgcgtcgaacccctgctgcgc
cgcatccgcaacgagatggccggcgccggcctcaccgtcgagtccgccaagggcgagtgc
aaccccggccagcacgagatcgccttccgctacgacgaggccctggtcacctgcgaccag
cacgccgtctacaagaccggcgccaaggagatcgccgcccaggagggcatgtccctcacc
ttcatggccaagtacaacgagctggaaggcaactcctgccacatccacctctcgctcgcc
gacgccgacggccgcaacgccatggccgagggagggggaatgtccgacgtcatgcggcac
ttcctcgccggacagctggtggcgctgcgcgagttctccctcctctacgccccgcacatc
aactcctacaagcgcttccagcccggttccttcgcccccaccgccgtcgcctggggccac
gacaaccgcacctgcgccctgcgcgtcgtcggccacggccgctccctccgtttcgagaac
cggctccccggcggcgacgtcaacccctacctcgcggtggccggcctggtcgcggccgga
ttgcacggcatcgagcagcggctggaactgcccgagccctgccccggcaacgcgtacacc
gccgacttcgcgcacgtccccaccaccctgcgcgaggccgccgagctgtgggagaacagc
accctggccaaggccgccttcggggacgaggtcgtcgcccactaccggaacatggcccgc
gtcgaactggacgccttcgacgccgccgtcaccgactgggaactgcgccgctccttcgaa
cgcatgtga

DBGET integrated database retrieval system