KEGG   Streptomyces coelicolor: SCO1659Help
Entry
SCO1659           CDS       T00085                                 

Gene name
glpF, SCI52.01
Definition
(RefSeq) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO1659 (glpF)
Transporters [BR:sco02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SCO1659 (glpF)
Ion channels [BR:sco04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   SCO1659 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 1097090
NCBI-ProteinID: NP_625934
Kitasato: SCO1659
UniProt: P19255
Position
1777840..1778634
Genome map
AA seq 264 aa AA seqDB search
MSSSDIFIGETIGTALLILLGGGVCAAVTLKASKARNAGWLAIAFGWGFAVMTAAYISGP
LSGAHLNPAVTVGIAIKDGDWSNTPTYFAGQLLGAMIGAVLVWVAYYGQFQAHLTDREIV
GGPGAQDTTAKSVEAQEKGAGPVLGVFSTGPEIRHTVQNLATEIIGTFVLLLAILTQGLN
DEGNGLGILGALITGFVVVSIGLSLGGPTGYAINPVRDLGPRIVHALLPLPNKGGSDWSY
AWIPVVGPLIGGAIAGGVYNVAFA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagctccgacatcttcatcggcgagaccatcggtaccgccctgctcatcctgctc
ggcggcggcgtgtgtgccgccgtcacgctcaaggcctccaaggcccgcaacgccggctgg
ctcgccatcgccttcgggtggggcttcgccgtcatgacggcggcgtacatatcgggtccg
ctctccggcgcccacctcaacccggccgtgaccgtcggcatcgcgatcaaggacggcgac
tggagcaacaccccgacctacttcgcgggtcagctcctcggcgcgatgatcggcgcggtc
ctggtctgggtcgcctactacggccagttccaggcccacctcaccgaccgcgagatcgtc
ggcggccccggcgcgcaggacacgacggccaagtccgtcgaggcgcaggagaagggcgcc
ggcccggtgctgggcgtcttctccaccggccccgagatccggcacacggtccagaacctc
gccacggagatcatcggcaccttcgtgctgctgctcgccatcctcacccagggcctgaac
gacgagggcaacggcctcggcatcctgggcgccctgatcaccgggttcgtggtggtctcc
atcggcctgtcgctcggcggcccgacgggctacgcgatcaacccggtccgcgacctcggc
ccgcgcatcgtgcacgccctgctgcccctgcccaacaagggcggctccgactggtcctac
gcctggatcccggtcgtcggtccgctgatcggcggtgcgatcgccggaggtgtgtacaac
gtcgcgttcgcctga

DBGET integrated database retrieval system