KEGG   Streptomyces coelicolor: SCO1660Help
Entry
SCO1660           CDS       T00085                                 

Gene name
glpK, SCI52.02
Definition
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sco  Streptomyces coelicolor
Pathway
sco00561  Glycerolipid metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO1660 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1660 (glpK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SCO1660 (glpK)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1660 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 1097091
NCBI-ProteinID: NP_625935
Kitasato: SCO1660
UniProt: Q9ADA7
Position
1778726..1780264
Genome map
AA seq 512 aa AA seqDB search
MTDSHTAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHDATEIWTN
VQEVVAGAVEKAGITRDDIKAIGITNQRETTLVWDKNTGEPVHNAIVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKARWLLDNVDGLRERAEAGDLLFGTMDTWVIWNLTG
GVNGGKHVTDVTNASRTMLMNLHTMAWDEKIAESIGVPMQMLPEIRSSAEVYGEITGGRL
GELLGGIPVASALGDQQAALFGQTCFSEGETKSTYGTGTFMVMNTGDKLINSYSGLLTTV
GYKIGDQDTVYALEGSIAVTGSLVQWMRDQMGLISTAAEIETLALTVEDNGGAYFVPAFS
GLFAPYWRSDARGVIAGLTRYVTKAHLARAVLEATAWQTREIADAMTKDSGVELTALKVD
GGMTSNNLLMQTLADFVDAPVVRPMVAETTCLGAAYAAGLAVGFWNSTDDLRANWRRAAE
WTPRMDADIRDREYKSWLKAVERTMGWLEDEE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactcccacaccgcaggccccttcatcgccgcgatcgaccagggcacgacctcc
tcgcgctgcatcgtcttcgaccgggacggacgcatcgtctccgtcgaccagaaggagcac
gagcagatcttccccaagccgggctgggtcgagcacgacgccaccgagatctggaccaac
gtccaggaggtcgtcgccggagccgtcgagaaggccggcatcacccgcgacgacatcaag
gccatcggcatcaccaaccagcgcgagaccaccctcgtctgggacaagaacaccggtgag
cccgtccacaacgccatcgtctggcaggacacccgcaccgacgccctgtgcaaggagctc
ggccgcaacgtcggccaggaccgcttccgccgcgagaccggcctgcccctcgcctcctac
ttcgccggtcccaaggcccgctggctgctcgacaacgtcgacggtctgcgcgagcgcgcc
gaggcgggcgacctgctcttcggcaccatggacacctgggtcatctggaacctgaccggc
ggggtgaacggcggcaagcacgtcaccgacgtcaccaacgcctcccgcaccatgctgatg
aacctgcacaccatggcgtgggacgagaagatcgccgagtcgatcggcgtcccgatgcag
atgctccccgagatccgctcctccgccgaggtgtacggcgagatcaccggcggccgcctc
ggcgagctgctcggcggcatcccggtcgcctccgcgctcggcgaccagcaggcggccctg
ttcggccagacctgcttctccgagggcgagaccaagtcgacgtacggcaccggcaccttc
atggtgatgaacaccggcgacaagctgatcaactcctactcgggcctgctgaccacggtc
ggctacaagatcggcgaccaggacacggtctacgccctggagggctcgatcgccgtcacc
ggttcgctggtgcagtggatgcgcgaccagatgggcctgatctccaccgccgccgagatc
gagaccctcgccctgaccgtcgaggacaacggcggcgcctacttcgtgccggccttctcc
ggcctgttcgccccgtactggcgttccgacgcccgcggtgtgatcgccggcctcacccgg
tacgtgaccaaggcgcacctcgcgcgcgccgtcctggaggccaccgcctggcagacgcgg
gagatcgcggacgccatgacgaaggactccggggtggagctgaccgccctcaaggtcgac
ggcggcatgacctccaacaacctgctgatgcagaccctcgccgacttcgtggacgccccc
gtggtgcgcccgatggtcgccgagaccacctgcctcggcgccgcctacgccgccggtctc
gccgtcggcttctggaacagcaccgacgacctgcgcgccaactggcggcgggccgccgag
tggaccccccgcatggacgcggacatccgcgaccgtgagtacaagagctggctcaaggcc
gtcgagcggaccatgggctggctcgaggacgaggagtaa

DBGET integrated database retrieval system