KEGG   Streptomyces coelicolor: SCO1661Help
Entry
SCO1661           CDS       T00085                                 

Gene name
SCI52.03
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00564  Glycerophospholipid metabolism
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO1661 (SCI52.03)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCO1661 (SCI52.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 GIDA HI0933_like 3HCDH_N FAD_binding_3 AlaDh_PNT_C Lycopene_cycl Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 1097092
NCBI-ProteinID: NP_625936
Kitasato: SCO1661
UniProt: Q9ADA6
Position
1780273..1781889
Genome map
AA seq 538 aa AA seqDB search
MTTQSTLQSVPALGTHPASGSNPSRAETREQLSKASYDLLVIGGGILGISTAWHAAQSGL
RVAVVDAGDFAGATSSASSKLLHGGLRYLQTGAVKLVAENHFERRAVSRQVAPHLANPLT
FYLPVYKGGPHGAAKLGAGVFAYSALSAFGDGVGHLLSPAKAAQDVPELRTDNLKAVAVY
GDDQMNDARMALMTVRAAVESGAVVLNHAEVTGLRFTGGRVTGAELKDRLSGDEFGVNAR
LVLNATGPWVDHLRRMEDPAAAPSIRLSKGAHLVLKRTAPWKAALATPIDKYRITFALPW
EDMLLLGTTDEEFEGDPADVAVNDKDITQILDEAAFSIRDQQLDRDLITYSFAGLRVLPG
GPGDTAKAKRETVVTEGRGGMLSVAGGKWTTFRHIGRTVMKKLEALPGHPLGDDFEPIAS
LPKKLPLPGVANPRAVAHRLLVDGSAPGPRMAADTARHLATHYGSLAFDIARLANESPEL
ARRVHPDAPEIWAQVVWARDNEWAETADDVLRRRTTLTIRGLATDDVRAQVQDVLDKK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcagtccaccctgcagtccgtgcctgccctgggtacgcacccggcctccggc
tccaacccgagccgggccgagacccgggagcagctctccaaggcgtcgtacgaccttctc
gtgatcggcggcggcatcctgggcatctccaccgcctggcacgccgcgcagtccggcctc
agggtggccgtggtcgacgccggcgacttcgccggtgccacctcctccgcctcctccaag
ctgctccacggcggactgcgctacctgcagaccggcgcggtgaagctggtggcggagaac
cacttcgaacgccgtgcggtctcccgccaggtggccccccacctggcgaacccgctcacc
ttctacctccccgtgtacaagggcggaccgcacggcgcggcgaagctcggggccggcgtc
ttcgcgtactcggcgctgtccgccttcggtgacggcgtcggccacctgctctccccggcc
aaggccgcgcaggacgtgcccgagctgcgcaccgacaacctcaaggccgtggccgtgtac
ggcgacgaccagatgaacgacgcccgcatggccctgatgaccgtccgcgcggcggtcgag
tccggcgcggtggtcctcaaccacgccgaggtcaccggcctgcgcttcacgggcggccgg
gtgaccggcgccgagctgaaggaccggctgtccggcgacgagttcggcgtgaacgcccgc
ctggtgctcaacgccaccggcccgtgggtcgaccacctgcgccgcatggaggacccggcc
gcggcgccgtcgatccggctctccaagggcgcgcacctggtgctcaagcgcaccgcgccg
tggaaggccgcgctggccaccccgatcgacaagtaccggatcaccttcgccctcccctgg
gaggacatgctgctgctcggcaccaccgacgaggagttcgagggcgacccggcggacgtc
gcggtcaacgacaaggacataacccagatcctggacgaggccgcgttctccatccgcgac
cagcagctcgaccgggacctcatcacgtactccttcgcgggtctgcgggtgctgccgggc
ggtcccggcgacacggcgaaggccaagcgcgagacggtcgtgaccgagggccggggcggc
atgctgtccgtcgccggcggcaagtggaccaccttccgccacatcggccgtacggtgatg
aagaagctggaggcgctgccgggccacccgctgggcgacgacttcgagccgatcgcgtcg
ctgccgaagaagctgccgctgcccggcgtcgccaacccgcgcgcggtcgcccaccggctg
ctggtggacggttcggcgcccggcccgcgcatggcggcggacaccgccaggcacctggcc
acgcactacggttcgctcgccttcgacatcgcccggctcgccaacgagagcccggagctg
gcgcggcgcgtccacccggacgccccggagatctgggcgcaggtcgtgtgggcccgggac
aacgagtgggccgagacggcggacgacgtgctgcgccgccgtacgaccctgacgatccgg
ggcctggccacggacgacgtccgcgcgcaggtccaggacgtgctggacaagaagtag

DBGET integrated database retrieval system