KEGG   Streptomyces coelicolor: SCO1679Help
Entry
SCO1679           CDS       T00085                                 

Gene name
SCI52.21
Definition
(RefSeq) gluconokinase
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1679 (SCI52.21)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     SCO1679 (SCI52.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 DUF2075 AAA_30 Cytidylate_kin AAA_22 AAA_16 PhoH ATPase AAA Cytidylate_kin2 AAA_28 SRP54
Motif
Other DBs
NCBI-GeneID: 1097110
NCBI-ProteinID: NP_625954
Kitasato: SCO1679
UniProt: Q9AD88
Position
1798561..1799088
Genome map
AA seq 175 aa AA seqDB search
MQQLHTPHVVVVMGVAGTGKTTIGPLLAARLGVPYAEGDDFHPPANIAKMTAGTPLTDED
RWPWLDAIGGWAHGRAGLGGVVSSSALKRSYRDRLRAAAPGVVFVHLTGSRELIEDRMSH
RQGHFMPTALLDSQFATLQPLQPDEAGVAVDVAGTPEEITERAVDALKGLPGPVQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactgcacaccccccacgtggtcgtggtcatgggcgtcgcgggcaccgggaag
accaccatcggtcccctgctcgcggcccggctcggcgttccctacgccgagggcgacgac
ttccaccctccggccaacatcgccaagatgacggccggcaccccgctcaccgacgaggac
cgctggccctggctggacgccatcggcggctgggcgcacgggcgtgccgggctcggtggg
gtggtgagcagttcggcgctgaagcggtcgtaccgcgaccggctgcgggccgccgctccc
ggtgtcgtcttcgtgcatctcacgggcagccgtgagctgatcgaggaccggatgtcgcac
cggcagggccacttcatgccgacggccctgctcgactcccagttcgccacgctccagccg
ctgcagccggacgaggcgggagtcgcggtggacgtcgccggcacccccgaggagatcacc
gaacgggcggtcgacgccctgaagggccttcccgggccggtccagtaa

DBGET integrated database retrieval system