KEGG   Streptomyces coelicolor: SCO1760Help
Entry
SCO1760           CDS       T00085                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Module
sco_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1760 (cmk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     SCO1760 (cmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytidylate_kin Cytidylate_kin2 AAA_18 AAA ABC_tran AAA_22 AAA_33 SKI AAA_6 AAA_17 Rad17
Motif
Other DBs
NCBI-GeneID: 1097191
NCBI-ProteinID: NP_626032
Kitasato: SCO1760
UniProt: Q9EWW6
Position
complement(1881032..1881727)
Genome map
AA seq 231 aa AA seqDB search
MENGAAPTAPAVIVAIDGPSGTGKSSTSKAVAAQLGLSYLDTGAQYRAITWWMVTNGIDT
DDPHAVAAAAGKPEIVSGTDPAGPTITVDGVDVAGPIRTQEVTSKVSAVSAVPEVRARIT
ELQRTIAAAAPLGIVVEGRDIGTTVLPDADLKIFLTASAEARAARRSGELKGADVHATRE
ALIKRDAADSSRKTSPLAKAGDAVEVDTTALSLPQVIECVVTLVEEKRAGK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacggcgccgccccgaccgccccggccgtgattgtcgccatcgacggcccctcc
ggcacgggcaagtcgagcacgtcgaaggccgtggccgcacagctcggcctcagctacctg
gacaccggtgcgcagtaccgggcgatcacgtggtggatggtcaccaacggcatcgacacc
gacgacccgcacgccgtcgccgccgcggccggcaagcccgagatcgtctccggcaccgac
ccggccggcccgaccatcacggtcgacggcgtggacgtggccggaccgatccgcacccag
gaggtcacctccaaggtcagcgcggtcagcgccgtaccggaggtccgcgcccggatcacc
gagctgcagcgcaccatcgccgccgccgcgccgctcggcatcgtcgtcgagggccgcgac
atcggcaccaccgtgctgccggacgccgacctcaagatcttcctcaccgcctcggcggag
gcccgcgccgcccgccgcagcggcgagctgaagggcgccgacgtccacgccacccgcgag
gccctgatcaagcgggacgccgccgactccagccgcaagacctccccgctggccaaggcc
ggcgacgcggtcgaggtggacaccaccgccctcagcctgccgcaggtcatcgagtgcgtc
gtcaccctcgtcgaggagaagcgggccgggaagtga

DBGET integrated database retrieval system