KEGG   Streptomyces coelicolor: SCO1761Help
Entry
SCO1761           CDS       T00085                                 

Gene name
2SCI34.14c, SCI51.01c
Definition
(RefSeq) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00401  Novobiocin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1761 (2SCI34.14c)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO1761 (2SCI34.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SCO1761 (2SCI34.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH 3HCDH_N DAO FAD_binding_2 ACT_6 ACT FAD_binding_3 TrkA_N Pyr_redox F420_oxidored NAD_binding_8 NAD_binding_2 GIDA GFO_IDH_MocA AlaDh_PNT_C ApbA 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 1097192
NCBI-ProteinID: NP_733544
Kitasato: SCO1761
UniProt: Q8CK19
Position
complement(1882015..1883100)
Genome map
AA seq 361 aa AA seqDB search
MRTALVIGTGLIGTSAALALTERGVTVHLADHDPEQARTAAALGAGTDEAPDGPVDLAVV
AAPPALVADVLADAMARGLARGYIDVASVKGGPRRELEARGLDLSAYIGTHPMSGREKSG
PLAATADLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVSHMP
HLVSSMVAARLEHAEEAAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTDVAA
DLEETVRALRALQSTDEDKRREGGTGIAEVLRRGNAGQVRVPGKHGSAPRSYETVAVLID
DQPGQLARIFADAGRAGVNVEDVRIEHATGQQAGLVQLMVEPKAAAVLTAALKERGWAIR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaccgcactcgtcatcggcaccggcctcatcggcacctccgccgccctcgccctc
accgaacgcggtgtcaccgtccacctcgcggaccacgaccccgagcaggcccgcaccgcc
gcagcgctcggcgccggcaccgacgaggccccggacgggccggtcgacctcgccgtcgtc
gccgcaccgcccgccctggtggccgacgtgctcgccgacgccatggcccgcggcctcgcc
cgcggctacatcgacgtggccagcgtcaagggcggcccccggcgggagctggaggcgcgc
gggctcgacctctcggcgtacatcggcacccaccccatgtcaggacgggagaagtccggc
ccgctggccgccaccgccgacctcttcgagggccgtccctgggtgctgacccccacccgg
gacaccgacaccgaggtgctgaacctcgccctggagctggtctcgcactgccgcgcggtg
cccgtcgtgatggacgccgacgcccacgaccgcgccgtggccctcgtctcccacatgccc
cacctggtctccagcatggtcgccgcgcgcctggagcacgccgaggaggccgccgtacgg
ctgtgcgggcagggcatccgcgacgtgacccggatcgccgcctccgacccccggatgtgg
atcgacatcctctccgccaaccccgggccggtcgccgacctgctcaccgacgtcgccgcc
gacctggaggagacggtacgggccctgcgtgccctgcagtccaccgacgaggacaagcgc
cgcgagggcggcaccggcatcgccgaggtgctgcggcgcggcaacgccggacaggtccgc
gtccccggcaagcacgggtcggccccgcggtcctacgagacggtggccgtcctcatcgac
gaccagcccggtcagctggcccgcatcttcgcggacgcgggacgagccggggtcaacgtg
gaggacgtacggatcgagcacgcgaccgggcagcaggcgggtctggtgcagctcatggtg
gagccgaaggccgccgccgtcctcacggcggccctgaaggaacggggctgggcgatccgg
cagtga

DBGET integrated database retrieval system