KEGG   Streptomyces coelicolor: SCO1776Help
Entry
SCO1776           CDS       T00085                                 

Gene name
pyrG
Definition
(RefSeq) CTP synthetase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Module
sco_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1776 (pyrG)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     SCO1776 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA GATase_3
Motif
Other DBs
NCBI-GeneID: 1097207
NCBI-ProteinID: NP_626047
Kitasato: SCO1776
UniProt: Q9S224
Position
complement(1896671..1898320)
Genome map
AA seq 549 aa AA seqDB search
MPPKSSTTKHIFVTGGVASSLGKGLTASSLGMLLKARGLRVVMQKLDPYLNVDPGTMNPF
QHGEVFVTNDGAETDLDIGHYERFLDRDLDGSANVTTGQVYSTVIAKERRGEYLGDTVQV
IPHITNEIKHRIRRMATDEVDVVITEVGGTVGDIESLPFLETVRQVRHEVGRDNVFVVHI
SLLPYIGPSGELKTKPTQHSVAALRNIGIQPDAIVLRCDREVPTAIKRKISLMCDVDEAA
VVACPDARSIYDIPKVIHTEGLDAYVVRRMDLPFRDVDWTTWDDLLDRVHNPEHEIVMAL
VGKYIDLPDAYLSVTEALRAGGFANKARVKIKWVTSDDCKTPAGARVQLGDVDAICIPGG
FGERGVTGKVGAIQYARENGIPLLGLCLGLQCIVVEAARNLAGVADANSTEFDPATAHPV
VSTMAEQLDIVAGEGDMGGTMRLGMYPAKLAEGSIVREVYDGKEYVEERHRHRYEVNNAY
RAELEKKAGIVFSGTSPDGKLVEYVEYPRDVHPYLVATQAHPELRSRPTRPHPLFAGLVK
AAVERKTSK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaatcctcgacgaccaagcacatcttcgtcaccgggggtgtcgcctcctcg
ctcggcaaggggctcaccgcctccagcctcggcatgctgctcaaggccaggggcctgcgc
gtcgtgatgcagaagctcgacccgtacctgaacgtcgaccccggcacgatgaaccccttc
cagcacggtgaggtcttcgtcaccaacgacggcgccgagaccgacctggacatcggccac
tacgagcgcttcctcgaccgcgacctcgacggctcggccaacgtcaccaccggccaggtg
tactccacggtgatcgccaaggagcggcgcggcgagtacctgggcgacaccgtccaggtc
atcccgcacatcaccaacgagatcaagcaccgcatccgccgcatggcgacggacgaggtc
gacgtcgtgatcaccgaggtcggcggcaccgtcggcgacatcgagtcgctgccgttcctg
gagaccgtccgccaggtccggcacgaggtcggccgcgacaacgtgttcgtcgtgcacatc
tcgctcctgccctacatcggcccctcgggcgagctgaagaccaagcccacccagcacagc
gtcgccgccctgcgcaacatcggcatccagccggacgcgatcgtcctgcgctgcgaccgc
gaggtcccgaccgcgatcaagcgcaagatctccctgatgtgcgacgtcgacgaggcggcc
gtggtggcctgccccgacgcccgctccatctacgacattccgaaggtcatccacaccgag
ggcctggatgcctacgtcgtccgcaggatggacctgccgttccgcgacgtggactggacc
acctgggacgacctgctcgaccgggtccacaaccccgagcacgagatcgtcatggccctg
gtcggcaagtacatcgacctgcccgacgcctacctctcggtcaccgaggcgctgcgcgcg
ggcggcttcgccaacaaggcgcgggtgaagatcaagtgggtcacgtccgacgactgcaag
accccggccggcgccagggtccagctcggcgacgtcgacgcgatctgcatcccgggcggc
ttcggcgagcgcggtgtgaccggcaaggtgggcgcgatccagtacgcccgtgagaacggg
atcccgctgctcggcctctgcctcggcctgcagtgcatcgtcgtcgaggccgcgcgcaac
ctggccggtgtcgcggacgccaactccaccgagttcgaccccgccaccgcccacccggtc
gtctccaccatggccgagcagctggacatcgtggccggcgagggcgacatgggcggcacc
atgcggctcggtatgtacccggcgaagctggccgagggctccatcgtgcgcgaggtctac
gacggcaaggagtacgtcgaggagcggcaccgccaccgctacgaggtgaacaacgcctac
cgcgcggagctggagaagaaggccggcatcgtcttctcgggcacctccccggacggcaag
ctcgtcgagtacgtcgagtacccgcgcgacgtccacccctacctggtcgccacgcaggcg
cacccggagctgcgctcgcgcccgacccgcccgcacccgctcttcgccgggctggtcaag
gccgcggtcgagcggaagacgtcgaagtaa

DBGET integrated database retrieval system