KEGG   Streptomyces coelicolor: SCO1859Help
Entry
SCO1859           CDS       T00085                                 

Gene name
SCI39.06
Definition
(RefSeq) hypothetical protein
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco00350  Tyrosine metabolism
sco00360  Phenylalanine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00401  Novobiocin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO1859 (SCI39.06)
   00350 Tyrosine metabolism
    SCO1859 (SCI39.06)
   00360 Phenylalanine metabolism
    SCO1859 (SCI39.06)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1859 (SCI39.06)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO1859 (SCI39.06)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO1859 (SCI39.06)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SCO1859 (SCI39.06)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO1859 (SCI39.06)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1097293
NCBI-ProteinID: NP_626126
Kitasato: SCO1859
UniProt: Q93RW7
Position
1992485..1993504
Genome map
AA seq 339 aa AA seqDB search
MRDDGAALVDLAVNVRAGTPPAWLREHVAASLGSLAAYPDGRAARAAVAARHGLPVERVL
LTAGAAEAFVLLARALKVRRPVVVHPQFTEPETALRDAGHTVGRVLLRAADGFRLDPAAV
PEDADLVVVGNPTNPTSVLHPADVLASLARPGRTLVVDEAFMDAVPGEREALAGRTDVPG
LVVLRSLTKTWGLAGLRIGYVLADPETVAGLERAQPLWPVSTPALAAAEACVAPRALAEA
AHAAHRVAADRDRLVAGLAVSAGAGVRVVGPAEGPFVLVGVPDGAAVRHRLRDLGYAVRR
GDTFPGLGGGWLRLAVRDRATTEGFLNALDRALTATEPA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgacggtgcggcgctggtggacctcgcggtgaacgtccgcgcgggcactccc
ccggcctggctgcgcgagcacgtcgccgcctcactcggttcgctcgcggcctacccggac
ggtcgggccgcgcgggcggcggtggcggcacggcacgggctgccggtggagcgggtgctg
ctgacggcgggcgcggcggaggcgttcgtgctgctggcgcgggcgctgaaggtgcgccgg
ccggtcgtggtgcacccccagttcaccgagcccgagacggcgctgcgggacgcggggcac
acggtcggccgggtgctgctgcgggcggcggacggcttccgcctcgaccccgccgccgtc
cccgaggacgccgacctggtggtggtcggcaacccgacgaacccgacctcggtgctgcac
ccggcggacgtactcgcgtcgctggctcggcccgggcggacgctggtcgtggacgaggcg
ttcatggacgcggtgccgggcgagcgggaggcgctggccgggcggacggacgtacccggg
ctcgtcgtgctgcgcagcctcaccaagacgtggggactggcggggctgcgcatcgggtac
gtcctcgcggacccggaaacggtcgccgggctggagcgcgcgcagccgctgtggccggtg
tccacgcccgcgctggcggcggccgaggcgtgcgtggcgccgcgggcgctggcggaggcc
gcccacgccgcccaccgcgtcgccgccgaccgggaccggctcgtcgccgggctggcggtg
tcggccggtgccggcgtgcgggtcgtcggaccggccgagggccccttcgtcctggtcggc
gtcccggacggggccgccgtacggcaccggttgcgcgacctggggtacgcggtccggcgc
ggggacacgttccccggtctgggcggcgggtggctgcggctggcggtacgggaccgggcg
acgacggagggcttcctgaacgccctggatcgcgcgctgacggcgacggaaccggcctga

DBGET integrated database retrieval system