KEGG   Streptomyces coelicolor: SCO1912Help
Entry
SCO1912           CDS       T00085                                 

Gene name
SCI7.30
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00261  Monobactam biosynthesis
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SCO1912 (SCI7.30)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO1912 (SCI7.30)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     SCO1912 (SCI7.30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS PA
Motif
Other DBs
NCBI-GeneID: 1097346
NCBI-ProteinID: NP_626178
Kitasato: SCO1912
UniProt: Q9X9W0
Position
2048176..2049129
Genome map
AA seq 317 aa AA seqDB search
MELHCLAADTTPMTTDDDSAPFGRSLCAMVTPFTGSGALDLDGAQRLADRLVARGCDGLV
LSGTTGESPTTTDAEKAALVTAVREAVGDRAALVAGVGTADTRHTVELALAAEKAGADGL
LVVAPYYSRPPQDALEAHFREVADASGLPVMLYDIPGRTGTRIEPDTVVRLAAHPRIVAV
KDCAYDLLGTQKVLSRTGLAYYAGCDEQILPLYAIGAAGYVSTVANVVPELFRAVLDAFD
AGDTGRAALLQRRAVPLVESMMAAGLPGTVTAKALLGALGLPAGPVRAPLRSADRETTAG
LLAAYGELAADAGQSQA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacactgtctggccgccgacactactcccatgacgacagacgacgactccgcc
cccttcggccgcagcctgtgcgccatggtcacgcccttcaccggctccggcgctctcgac
ctcgacggtgcccagcggctcgccgaccggctggtcgcgcggggctgtgacggcctggtg
ctgtccggcaccacgggcgagtcgccgaccaccacggacgccgagaaggcggccctggtg
acggcggtcagggaggcggtcggggaccgcgcggcactcgtcgccggggtcggcaccgcg
gacacccggcacaccgtggaactggccctggcggccgagaaggccggcgcggacggactg
ctggtggtcgcgccgtactacagcaggccgccgcaggacgccctggaggcgcacttccgc
gaggtcgccgacgcgagcggcctgcccgtgatgctgtacgacatcccgggccgcaccggc
acccgtatcgaacccgacaccgtcgtccggctcgccgcgcacccgcgcatcgtcgccgtc
aaggactgcgcctacgacctcctcggcacccagaaggtgctgtcccgcaccggtctggcc
tactacgcgggctgcgacgaacagatcctccccctctacgcgatcggagcggcggggtac
gtcagcaccgtcgccaacgtcgtgccggagctgttccgggccgtcctcgacgccttcgac
gcgggcgacaccggccgggccgcgctgctccagcggcgggcggtcccgctcgtcgagtcg
atgatggcggccggtctgcccggcacggtcaccgccaaggccctcctcggcgcgctgggc
ctgccggcgggcccggtccgcgcaccgctgcggtccgcggaccgggagaccaccgccggt
ctgctggcggcctacggagaactggccgccgacgccggtcagtcccaggcgtag

DBGET integrated database retrieval system