KEGG   Streptomyces coelicolor: SCO1936Help
Entry
SCO1936           CDS       T00085                                 

Gene name
SCC22.18, tal2
Definition
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1936 (SCC22.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     SCO1936 (SCC22.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA DisA-linker TPR_10
Motif
Other DBs
NCBI-GeneID: 1097370
NCBI-ProteinID: NP_626201
Kitasato: SCO1936
UniProt: Q9XAC0
Position
2068835..2069953
Genome map
AA seq 372 aa AA seqDB search
MTDALKRLSDEGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPSIFQKAISQGDGYD
QQLADLAVRGVTVEEAIRMITTADVRDAADILRPVYDNTGGKDGRVSIEVDPRLAHNTHA
TVAEAKQLAWLVDRPNTFIKIPATEAGLPAIAETIGLGISVNVTLIFSLERYRKVMDAFL
TGLEKAKERGLDLSQIHSVASFFVSRVDTEIDKRIDALGTDEAKAQRGKAAVANARLAYQ
AYEEVFGTDRWAALEKAGANKQRPLWASTGVKDKAYSDTMYVTDLVAPNTVNTMPEATLL
ATEDHGEITGDAVAGSYERARADLDAIEKLGISYDEVVQLLEKEGVDKFEDAWNDLLKST
EAELKRLAPSKG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcactcaagcgcctctccgatgaaggcgtggcgatctggctggacgacctg
tcgcgcaagcggatcacgtccggcaacctcgccgagctgatcgaccagcagcacgtcgtg
ggcgtcaccaccaacccgtcgatcttccagaaggccatctcgcagggcgacggctacgac
cagcagctcgccgacctcgccgtccgcggagtcacggtcgaagaggccatccgcatgatc
accacggcggacgtccgcgacgccgccgacatcctgcgccccgtctacgacaacaccggc
ggcaaggacggccgggtctccatcgaggtggacccgcggctggcgcacaacacccacgcc
acggtggccgaggccaagcagctggcgtggctggtggaccggccgaacaccttcatcaag
atcccggcgaccgaggcgggcctgccggccatcgccgagaccatcggcctgggcatcagc
gtcaacgtcacgctgatcttctccctggagcgctaccgcaaggtcatggacgccttcctg
accggcctggagaaggccaaggagcgtggcctggacctctcgcagatccactccgtggcg
tccttcttcgtgtcccgcgtggacaccgagatcgacaagcggatcgacgcgctcggcacc
gacgaggccaaggcgcagcgcggcaaggccgccgtcgccaacgcccgcctggcctaccag
gcgtacgaggaggtcttcggcaccgaccgctgggccgccctggagaaggccggcgccaac
aagcagcgtccgctgtgggcgtcgaccggtgtgaaggacaaggcgtacagcgacaccatg
tacgtcaccgacctggtcgcgccgaacacggtcaacaccatgccggaggccacgctgctg
gccaccgaggaccacggcgagatcaccggcgacgccgtcgccgggtcgtacgagcgggcc
cgcgcggacctcgacgcgatcgagaagctcgggatctcctacgacgaggtggtccagctc
ctggagaaggaaggcgtcgacaagttcgaggacgcctggaacgacctgctgaagtccacg
gaggcggagctcaagcgcctcgctccctcgaagggctga

DBGET integrated database retrieval system