KEGG   Streptomyces coelicolor: SCO1937Help
Entry
SCO1937           CDS       T00085                                 

Gene name
SCC22.19, zwf2
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00480  Glutathione metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1937 (SCC22.19)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO1937 (SCC22.19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1937 (SCC22.19)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SCO1937 (SCC22.19)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SCO1937 (SCC22.19)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SCO1937 (SCC22.19)
  Exosomal proteins of colorectal cancer cells
   SCO1937 (SCC22.19)
  Exosomal proteins of bladder cancer cells
   SCO1937 (SCC22.19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 1097371
NCBI-ProteinID: NP_626202
Kitasato: SCO1937
UniProt: Q9XAB9
Position
2069957..2071480
Genome map
AA seq 507 aa AA seqDB search
MSSSNPLRDPADRRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPGFSLVGF
ARRDWEHEDFAQVVHDAVKEHSRTPFREEVWQQLIQGMRFVQGTFDDDDAFERLRGTIEE
LDKAQGTGGNFAFYLSVPPKSFPVVIQQLKKHGLADQTNGSWRRAVIEKPFGHDLKSAEE
LNAIVHEVFGSDQVFRIDHYLGKETVQNILALRFANTMFEPIWNRSYVDHIQITMAEDIG
IGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPASFDADALAAEKTKVLGAVRLPKDLG
RDTVRGQYAAGWQGGAKAVGYLEEDGIDPKSKTDTYAAIKVGIDNRRWAGVPFYLRTGKR
LGRRVTEIAVVFQRAPHSPFDTTATEELGSNAIVIRVQPDEGVTVRFGSKVPGTSMEIRD
VSMDFAYGESFTESSPEAYERLILDVLLGDANLFPRTEEVELSWKILDPIEEYWDEHGTP
AQYPAGTWGPVEADDMLERDGRSWRRP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaagcagcaatccgctgcgtgaccccgcagaccgacggctcccgcgcatcgcgggg
ccgtcgggtctggtcatcttcggcgtcaccggcgatctgtcccgcaagaagctcatgccc
gccgtgtacgacctcgccaaccggggtctgctgccgccgggcttctcgctcgtcgggttc
gcccgccgggactgggagcacgaggacttcgcccaggtcgtgcacgacgccgtcaaggag
cactcccgcacgccgttccgcgaggaggtctggcagcagctcatccaggggatgcgcttc
gtgcagggcaccttcgacgacgacgacgccttcgagcggctgcgcggcaccatcgaggag
ctggacaaggcacagggcacgggcggcaacttcgccttctacctgtcggtgccgccgaag
tccttcccggtggtcatccagcagctcaagaagcacggactggccgaccagacgaacggc
tcctggcggcgggcggtgatcgagaagcccttcggccacgacctgaagtcggccgaggag
ctgaacgccatcgtccacgaggtcttcggctccgaccaggtcttccgcatcgaccactac
ctgggcaaggagaccgtccagaacatcctggcgctgcgcttcgccaacacgatgttcgag
ccgatctggaaccggtcctacgtcgaccacatccagatcaccatggccgaggacatcggc
atcggcggccgggccggctactacgacgggatcggcgcggcgcgtgacgtcatccagaac
cacctgctccagctgctcgcgctgaccgcgatggaggagcccgcctccttcgacgcggac
gcgctggcggcggagaagaccaaggtgctcggcgcggtccgcctccccaaggacctgggc
cgggacaccgtgcgcggccagtacgcggcggggtggcagggcggcgccaaggccgtcggt
tacctcgaagaggacggcatcgaccccaagtcgaagaccgacacctacgccgcgatcaag
gtgggcatcgacaaccgccgctgggcgggtgtccccttctacctgcgcaccggcaagcgg
ctgggccgccgggtcacggagatcgcggtcgtcttccagcgggccccgcactcccccttc
gacacgacggccaccgaggaactcggctcgaacgcgatcgtcatccgcgtccagcccgac
gagggcgtcaccgtccgcttcggttccaaggtgccgggcacgtcgatggagatccgggac
gtgtcgatggacttcgcctacggcgagtccttcaccgagtccagcccggaggcgtacgag
cgcctgatcctggacgtcctgctcggcgacgccaacctcttcccgcgcaccgaggaggtc
gagctgtcctggaagatcctcgacccgatcgaggagtactgggacgagcacggcaccccg
gcccagtacccggccggcacctgggggcccgtcgaggcggacgacatgctggaacgagac
ggacggagctggcgccggccatga

DBGET integrated database retrieval system