KEGG   Streptomyces coelicolor: SCO1939Help
Entry
SCO1939           CDS       T00085                                 

Gene name
SCC22.21
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1939 (SCC22.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     SCO1939 (SCC22.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Sugar-bind
Motif
Other DBs
NCBI-GeneID: 1097373
NCBI-ProteinID: NP_626204
Kitasato: SCO1939
UniProt: Q9XAB7
Position
2072529..2073314
Genome map
AA seq 261 aa AA seqDB search
MSDTPQLVVHRDKELMAEAAAARLITKIVDAQASRGSASVVLTGGRNGNGLLAALAGSPA
RDAIDWSRLDLWWGDERFLPEGDPERNVTQAQQALLDSVPLDPKRVHAMAASDGPYGSDV
EAAAAAYAQELATASVPENHAAVPSFDVLLLGVGPDTHVASLFPEHPGVRETERTVIGVH
GSPKPPPIRISLTLPAIRAAREVWLLAAGEDKANAVAMALSGAGEIQAPAAGARGRARTL
WLLDSAAASQLPRSLYPPASA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccccgcagctggtcgtgcaccgtgacaaggagctgatggccgaggccgcg
gcggcccgtctgatcacgaagatcgtggacgcgcaggcctcccggggcagcgcgtccgtg
gtcctcaccggcggccgcaacggcaacggcctgctcgcggcgctggccggctctccggcc
cgggacgcgatcgactggagccgcctcgacctgtggtggggcgacgagcggttcctgccg
gagggcgacccggagcgcaacgtcacccaggcgcagcaggcactcctcgactcggtgccg
ctggacccgaaacgggtgcacgcgatggcggcctccgacggcccctacggttcggacgtg
gaggcggcagcggcggcctacgcgcaggaactggccacggcctccgtccccgagaaccac
gccgcggtcccgtccttcgacgtcctgctcctcggcgtcggcccggacacccacgtggcg
tcgctcttcccggagcacccgggagtccgggagacggagcgcacggtgatcggcgtccac
ggctcccccaagccgccgcccatccgcatctccctgacccttcccgccatccgcgccgcc
cgtgaggtgtggctgctggcggcgggcgaggacaaggcgaacgcggtggcgatggccctg
tcgggcgcgggcgagatccaggccccggcagcgggcgcccggggccgcgcccgcaccctg
tggctcctggactcggctgcggcgtcccaactgccgaggtcgctgtacccaccggcttcg
gcgtag

DBGET integrated database retrieval system