KEGG   Streptomyces coelicolor: SCO1942Help
Entry
SCO1942           CDS       T00085                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1942 (pgi)
   00030 Pentose phosphate pathway
    SCO1942 (pgi)
   00500 Starch and sucrose metabolism
    SCO1942 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO1942 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1942 (pgi)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     SCO1942 (pgi)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO1942 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1942 (pgi)
  Exosomal proteins of colorectal cancer cells
   SCO1942 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 1097376
NCBI-ProteinID: NP_626206
Kitasato: SCO1942
UniProt: Q9Z523
Position
complement(2075313..2076968)
Genome map
AA seq 551 aa AA seqDB search
MNADGRTRLHQTPEWAALVKHREQLGEVRLREMFAADPGRGTGWTLRVGDLHVDYSKHLV
TDETLALLQELAAATGVSGLRDAMFRGERINITEDRAVLHTALRAPRDAVIEVDGENVVP
QVHAVLDKMAGFADRVRTGEWTGHTGRRIRNVVNIGIGGSDLGPAMAYEALRAFTDRSLT
LRFVSNVDGADLHEAVRDLDPAETLFIIASKTFTTIETITNATSARSWLLAGLGGDEKAV
AKHFVALSTNAEKVADFGIDTANMFEFWDWVGGRYSFDSAIGLSLMIAIGPDRFREMLDG
FHLVDEHFRTAPAESNVPLLMGLLGVWYGSFLGAQSHAVLPYSHYLSKFTAYLQQLDMES
NGKSVDREGKPVQWQTGPVVWGTPGTNGQHAYYQLIHQGTKLIPADFIGFARPVDELSEE
LKSQHDLLMANFFAQTQALAFGKTPDEVRAEGVPEELVPHKTFPGDHPTTTILARELTPS
VLGQLVALYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPALTEGADVPGLDPSTGAL
VAAYRELRGRR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagacggccgtaccaggctccaccagacgcccgaatgggccgcgctggtcaag
caccgcgagcagctcggcgaggtgcggctgcgcgagatgttcgccgccgacccggggcgc
ggcaccggctggacgctgcgcgtgggagacctgcacgtcgactactcgaagcacctggtc
accgacgagacgctggccctgctccaggagctggccgccgcgaccggcgtgtccgggctg
cgtgacgcgatgttccgcggtgagcgcatcaacatcaccgaggaccgggcggtcctgcac
accgcgctgcgggcgccgcgggacgcggtgatcgaggtcgacggcgagaacgtcgtcccc
caggtgcacgccgtgctggacaagatggccggcttcgccgaccgggtacgcaccggcgag
tggaccggccacaccggcaggcgcatcaggaacgtcgtcaacatcggcatcggcggctcc
gacctcggtccggcgatggcctacgaggcgctgcgggccttcaccgaccgctccctcacc
ctccgcttcgtgtccaacgtggacggcgccgacctgcacgaggcggtccgggacctggac
ccggcggagacgctgttcatcatcgcctccaagaccttcaccaccatcgagacgatcacc
aacgccacctccgcccgctcgtggctgctggccgggctcgggggtgacgagaaggcggtc
gcgaagcacttcgtggccctgtcgaccaacgccgagaaggtcgcggacttcggcatcgac
acggccaacatgttcgagttctgggactgggtcggcggccgctactccttcgactcggcc
atcggcctctccctgatgatcgccatcggcccggaccgcttccgggagatgctcgacggc
ttccacctggtcgacgagcacttccgcaccgcccccgccgagtccaacgtgccgctgctg
atggggctgttgggcgtctggtacggcagcttcctgggtgcgcagtcacacgcggtgctg
ccgtactcgcactacctgtcgaagttcaccgcgtacctgcagcagctcgacatggagtcc
aacggcaagtccgtcgaccgcgagggcaagcccgtgcagtggcagaccgggccggtggtg
tggggcacgccgggcaccaacgggcagcacgcctactaccagttgatccaccagggtacg
aagctgatcccggcggacttcatcggcttcgcccggcccgtggacgagctgagcgaggag
ctgaagtcccagcacgacctgctgatggccaacttcttcgcccagacccaggccctcgcc
ttcggcaagacccccgacgaggtacgcgccgagggagtgcccgaggaactggtcccgcac
aagaccttccccggcgaccacccgacgacgacgatcctcgcccgcgagctgaccccgtcg
gtgctggggcagctcgtcgcgctctacgagcacaaggtgttcgtgcagggcgcgatctgg
aacatcgactccttcgaccagtggggcgtcgaactcggcaaggtgctcgccaagcgtgtc
gaacccgccctcaccgagggcgccgacgtgcccggcctcgacccgtccacgggcgcgctg
gtggccgcctaccgggagttgcgcggcaggcgatga

DBGET integrated database retrieval system