KEGG   Streptomyces coelicolor: SCO1945Help
Entry
SCO1945           CDS       T00085                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00051  Fructose and mannose metabolism
sco00562  Inositol phosphate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00002  Glycolysis, core module involving three-carbon compounds
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1945 (tpiA)
   00051 Fructose and mannose metabolism
    SCO1945 (tpiA)
   00562 Inositol phosphate metabolism
    SCO1945 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO1945 (tpiA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCO1945 (tpiA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCO1945 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCO1945 (tpiA)
  Exosomal proteins of melanoma cells
   SCO1945 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1097379
NCBI-ProteinID: NP_626209
Kitasato: SCO1945
UniProt: Q9Z520
Structure
PDB: 

Position
complement(2078015..2078791)
Genome map
AA seq 258 aa AA seqDB search
MTTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYDAVEVAVLAPFTDLRSVQTLVDG
DKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVK
AAYKHGLTPILCVGEELDVREAGNHVEHTLAQVEGGLKDLAAEQAESVVIAYEPVWAIGT
GKVCGADDAQEVCAAIRGKLAELYSQELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVG
GASLDSDEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgccgctgatggcgggcaactggaagatgaacctcaaccacctggag
gccatcgcccacgtccagaagctcgccttcgccctcgcggacaaggactacgacgccgtc
gaggtcgccgtcctcgcccccttcaccgacctgcgctccgtgcagaccctggtcgacggg
gacaagctcaagatcaagtacggtgcccaggacatctccgcgcacgacggcggcgcctac
accggcgagatctcgggcccgatgctggccaagctgaagtgcacgtacgtggccgtcggc
cactccgagcgccggcagtaccacgccgagaccgacgagatcgtgaacgccaaggtcaag
gccgcctacaagcacggcctgaccccgatcctgtgcgtcggcgaggaactggacgtccgc
gaggcgggcaaccacgtcgagcacaccctcgcccaggtcgagggcggtctgaaggacctt
gcggccgagcaggccgagtccgtcgtgatcgcctacgagcccgtgtgggccatcggcacc
ggcaaggtctgcggcgccgacgacgcccaggaggtctgcgcggcgatccgcggcaagctc
gccgagctgtactcccaggagctggccgacaaggtccgcatccagtacggcggctccgtc
aagtccggcaacgtcgccgagatcatggccaagcccgacatcgacggcgccctggtcggc
ggcgcctcgctggactcggacgagttcgtcaagatcgtccgcttccgcgaccagtag

DBGET integrated database retrieval system