KEGG   Streptomyces coelicolor: SCO1957Help
Entry
SCO1957           CDS       T00085                                 

Gene name
SCC54.17
Definition
(RefSeq) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00051  Fructose and mannose metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO1957 (SCC54.17)
   00500 Starch and sucrose metabolism
    SCO1957 (SCC54.17)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO1957 (SCC54.17)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     SCO1957 (SCC54.17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1097391
NCBI-ProteinID: NP_626221
Kitasato: SCO1957
UniProt: Q9Z508
Position
2092928..2093836
Genome map
AA seq 302 aa AA seqDB search
MIVVAGEALIDLVPQGTGALAALRPALGGGPYNTAVALGRLGSPVAFCSRVSYDGFGEAL
LDRLRETGVDVSPVQRGAEPTTLAVASLDADGSAAYSFYVEGTADRMFALPAALPSGTRA
VSFGTCSLVLEPGASAYEELLRETAARGVFTALDPNIRAGLIPDPDAYRARFKSWLPSVS
LLKLSAEDAEWLGGTPREWLAAGPAAVVVTRGGDGLTAFTRDGGEYTVPGERVEVVDTIG
AGDTVNAALLHGLAARGALRDADLAALGPDGWAGLLGFAARAAAVTCSRAGAEPPYAHEV
AA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgtcgccggtgaggcactgatcgacctggtaccgcagggcacgggcgccctc
gccgcgctgcggcccgcgctcggcggcggtccgtacaacacggccgtcgcgctgggccgc
ctcggttcccccgtcgcgttctgctcgcgcgtgtcgtacgacggcttcggcgaggcgttg
ctggaccggctgcgcgagaccggcgtcgacgtctctccggtgcagcgcggggccgagccg
acgaccctcgccgtggcgtcgctcgacgcggacggctcggccgcgtactccttctacgtg
gagggaacggccgaccggatgttcgcgctgcccgccgcgctgccgtccggcacccgggcc
gtctccttcgggacctgttcgctggtcctggagccgggcgcgagcgcgtacgaggaactg
ttgcgcgagacggccgcgcggggtgtgttcaccgcgctggacccgaacatccgggccgga
ctgatcccggaccccgacgcctaccgggcccggttcaagagctggctgccgtcggtgtcg
ctgctgaagctgtccgccgaggacgccgagtggctcggcggcacgccccgggagtggctc
gcggcgggaccggccgcggtcgtggtcacccggggcggcgacgggctgacggccttcacc
cgggacgggggcgagtacacggtgccgggcgagcgcgtcgaggtggtggacacgatcggg
gcgggcgacacggtgaacgcggcactcctgcacggcctcgcggcgcggggcgctctccgc
gacgcggacctggccgccctgggtccggacggctgggccgggctgctgggcttcgccgcc
cgcgccgcggcggtcacctgttcccgcgcgggcgcggaaccgccgtacgcccatgaggtc
gccgcctga

DBGET integrated database retrieval system