KEGG   Streptomyces coelicolor: SCO1961Help
Entry
SCO1961           CDS       T00085                                 

Gene name
aroQ, SCC54.21c
Definition
(RefSeq) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1961 (aroQ)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     SCO1961 (aroQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-GeneID: 1097395
NCBI-ProteinID: NP_626225
Kitasato: SCO1961
UniProt: P15474
Structure
PDB: 

Position
complement(2099149..2099622)
Genome map
AA seq 157 aa AA seqDB search
MPRSLANAPIMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHE
GELVDWIHEARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHH
SYVSQRADGVVAGCGVQGYVFGVERIAALAGAGSARA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgcagcctggccaacgccccgatcatgatcctcaacggccccaacctgaacctg
ctcggccagcgccagccggagatctacggctccgacaccctcgccgacgtcgaggcgctg
tgcgtgaaggcggcggccgcgcacggcggcacggtggacttccggcagtccaaccacgag
ggcgaactggtcgactggatccacgaggcccggctgaaccactgcgggatcgtgatcaac
cccgccgcctactcgcacacgtccgtcgccatcctggatgcgctcaacacctgcgacggg
ctgccggtggtggaggtccacatctccaacatccaccagcgtgagccgttccggcaccac
tcctacgtctcgcagcgcgccgacggcgtcgtcgcggggtgcggtgtgcaggggtacgtc
ttcggtgtggagcggatcgccgccctggccggggcgggctcggccagggcctga

DBGET integrated database retrieval system