KEGG   Streptomyces coelicolor: SCO1977Help
Entry
SCO1977           CDS       T00085                                 

Gene name
SC3C9.12
Definition
(RefSeq) oxidoreductase
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00250  Alanine, aspartate and glutamate metabolism
sco00910  Nitrogen metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO1977 (SC3C9.12)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1977 (SC3C9.12)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     SCO1977 (SC3C9.12)
    1.4.1.14  glutamate synthase (NADH)
     SCO1977 (SC3C9.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 Amino_oxidase NAD_binding_8 Pyr_redox FAD_oxidored NAD_binding_7 Pyr_redox_3 HI0933_like FAD_binding_2 DAO FAD_binding_3 K_oxygenase 2-Hacid_dh_C AlaDh_PNT_C GIDA 3HCDH_N Thi4 FMO-like NAD_Gly3P_dh_N Lycopene_cycl F420_oxidored NAD_binding_2 IlvN Fer4_4 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 1097411
NCBI-ProteinID: NP_626239
Kitasato: SCO1977
UniProt: Q93JI5
Position
2115989..2117479
Genome map
AA seq 496 aa AA seqDB search
MADPKGFLTTPREEWPRRPAGERVRDWDEVYVPGALLPIVGRQADRCMDCGVPFCHEACP
LGNLIPEWNDLVSRSDWRAASERLHATNNFPEFTGRLCPAPCEAGCVLAINQPAVTIKNV
ECAIADTAWEEGFVPPLPPERLSGRTVAVIGSGPAGLAAAQQLTRAGHTVAVYERDDRIG
GLLRYGIPAFKMEKRHLERRVGQMRAEGTRFRTSAAVGRDVDAAALRTRYDAVVIATGAT
AWRELTVPGRELAGVHQAMEYLPLANRVCEGDLERSPLSAAGRHVVVVGGGDTGADCLGT
AVREGAASVTQLDIYARPGAERDERAEPWPTYPRLYRLSAAHEEARDLRSAPAADADARL
FAASTLRFTGDERGHVRALHLVGVDTGRRPLPGSERSLPADLVLLALGFSGPDRHDGLVD
GLGLDMEPRGTITRDRGFATNVPGVFAAGDAARGQSLVVWAIAEGRAVAAAVDRHLSGGS
TRLPAPVGPYDRPMTA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcccaagggttttctgacgacgccccgcgaggagtggccccgcagaccggcc
ggcgagcgggtccgggactgggacgaggtgtacgtcccgggagcgctgctgccgatcgtc
ggccggcaggccgaccggtgcatggactgcggcgtccccttctgccacgaggcctgtccg
ctgggcaacctgatcccggagtggaacgacctggtctcccggtcggactggcgggcggcg
agcgagcggctgcacgccacgaacaacttcccggagttcaccggccggttgtgtccggcg
ccgtgcgaggcgggttgtgtgctcgccatcaaccagcccgcggtcaccatcaagaacgtc
gagtgcgcgatcgcggacacggcctgggaggagggcttcgtcccgcccctgccgccggag
cggctgtccgggaggacggtggcggtgatcggctcgggaccggcggggctcgcggcggcg
cagcagttgacccgggccgggcacacggtcgcggtgtacgagcgcgacgaccggatcggt
gggctgctgcggtacgggatccccgcgttcaagatggagaagcggcacctggagcggcgt
gtcggccagatgcgggcggaggggacgaggttccgtacgtcggcggcggtcggacgggac
gtggacgccgcggcgctgcggacccgctacgacgcggtggtgatcgccaccggggcgacg
gcgtggcgggagctgaccgtgcccggccgggagctggcgggggtgcatcaggcgatggag
taccttccgctggccaaccgggtgtgcgagggcgacctcgagcgctccccgctgtccgcc
gccgggcggcacgtggtcgtcgtcggtggtggcgacacgggcgcggactgtctcggcacg
gcggtgcgggagggggccgcctccgtgacgcaactggacatctacgcgcggccgggtgcg
gagcgcgacgagcgggccgagccctggccgacctatccgcgcctgtaccggctgtcggcg
gcgcacgaggaggcacgcgacctgcggtccgcgccggcggcggacgcggacgcgcggctg
ttcgcggcgtccacgctccgcttcaccggcgacgagcgggggcatgtacgtgcgctgcac
ctggtcggggtggacacgggacgccgtccgctgcccggcagcgagcggtcgctcccggcg
gacctggtccttctcgccctcggcttctcggggcccgaccggcacgacgggctcgtcgac
gggctgggactggacatggagccccgtggcacgatcacccgggaccggggcttcgcgacc
aacgtcccgggggtgttcgccgccggggacgcggcgcgcgggcagtcactcgtcgtctgg
gcgatcgcggaggggcgggcggtggcggcggccgtggaccgccacctgtccggcggcagc
acccggctgccggccccggtcggcccgtacgaccggccgatgacggcctga

DBGET integrated database retrieval system