KEGG   Streptomyces coelicolor: SCO2019Help
Entry
SCO2019           CDS       T00085                                 

Gene name
SC7H2.33c
Definition
(RefSeq) chorismate mutase
  KO
K04092  chorismate mutase [EC:5.4.99.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2019 (SC7H2.33c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SCO2019 (SC7H2.33c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2 PSK_trans_fac
Motif
Other DBs
NCBI-GeneID: 1097453
NCBI-ProteinID: NP_626280
Kitasato: SCO2019
UniProt: Q9S2I4
Position
complement(2165374..2165724)
Genome map
AA seq 116 aa AA seqDB search
MTTSNTGTGAVEPAVREELARLRDSIDNIDAAVVHMLAERFKCTQQVGHLKARHQLPPAD
PAREAQQIARLRTLAESAKLDPAFAEKFLNFIVAEVIHHHERIAESNAAGGAPATD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcaacaccggtaccggtgccgtcgaacccgccgtccgcgaggagctggcc
cggctgcgggacagcatcgacaacatcgacgcggccgtcgtccacatgctcgccgagcgc
ttcaagtgcacccagcaggtcggccacctcaaggcccgccaccagctgccgcccgccgat
ccggcccgcgaggcccagcagatcgcccggctgcgcaccctcgccgaaagcgccaagctc
gacccggcgttcgccgagaagttcctgaacttcatcgtcgccgaggtgatccaccaccac
gagcgcatcgcggagagcaacgccgccggcggcgcaccggccaccgactga

DBGET integrated database retrieval system