KEGG   Streptomyces coelicolor: SCO2036Help
Entry
SCO2036           CDS       T00085                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2036 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2036 (trpA)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCO2036 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth KDGP_aldolase PcrB
Motif
Other DBs
NCBI-GeneID: 1097470
NCBI-ProteinID: NP_626296
Kitasato: SCO2036
UniProt: O68816
Position
complement(2187211..2188026)
Genome map
AA seq 271 aa AA seqDB search
MSGNVQLLNDTLAAAKSEGRAALIAYLPAGFPTVTGGIEAVKAALDGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVRIADVMRTVREAHEATGKPILVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHADKHGLATVFVVAPSSRDARLAEITAVGSGFVYAA
SLMGVTGTRASVGAQAEDLVRRTRATTDTPVCVGLGVSNAAQAAEVAGFADGVIVGSAFV
KRMLDAPDDAAGLEGVRALAADLAKGVRGQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggaacgtacagctgctgaacgacaccctcgccgcggcgaagtccgagggccgc
gccgccctgatcgcctacctcccggccgggttcccgaccgtgacgggcggcatcgaggcg
gtcaaggccgcgctcgacggcggcgccgacgtcgtcgaggtgggcctgccgcacagcgac
ccggtgctcgacggcccggtgatccagaccgccgacgacatcgcgctgcgcggcggcgtg
cggatcgccgacgtgatgcgcacggtccgcgaggcacacgaggccaccggcaagccgatc
ctcgtcatgacgtactggaaccccatcgaccgctacggcgtggagcgcttcaccgccgag
ctggccgaggccggcggcgccgggtgcatcctgcccgacctgcccgtccaggagtcggcg
ctgtggcgggagcacgcggacaagcacgggctcgccacggtcttcgtggtcgcgcccagc
agcagggacgcgcgcctcgccgagatcaccgcggtcggcagcggcttcgtctacgccgcc
tccctcatgggcgtcaccggcacccgcgcgtcggtcggcgcgcaggccgaggacctggtg
cgccgcacccgcgccaccaccgacaccccggtctgcgtcggcctcggagtctccaacgcc
gcccaggccgccgaggtggccggcttcgccgacggcgtgatcgtcggctcggccttcgtc
aagcggatgctggacgcgcccgacgacgcggccggcctggagggcgtccgcgcgctcgcc
gccgacctggcgaagggcgtgcgcggacaggcctga

DBGET integrated database retrieval system