KEGG   Streptomyces coelicolor: SCO2050Help
Entry
SCO2050           CDS       T00085                                 

Gene name
hisA, SC4G6.19c
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO2050 (hisA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2050 (hisA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     SCO2050 (hisA)
    5.3.1.24  phosphoribosylanthranilate isomerase
     SCO2050 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus IMPDH BAT TMP-TENI
Motif
Other DBs
NCBI-GeneID: 1097484
NCBI-ProteinID: NP_626310
Kitasato: SCO2050
UniProt: P16250
Structure
PDB: 

Position
complement(2197966..2198688)
Genome map
AA seq 240 aa AA seqDB search
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGT
GDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAE
HGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLE
LLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctcgaactcctccccgccgtcgacgtccgcgacggccaggccgtccgcctc
gtgcacggcgagtccggcaccgagacctcctacggctccccgctggaggccgccctcgcc
tggcagcgctccggcgccgagtggctgcacctggtggacctggacgcggcgttcgggacc
ggggacaaccgcgcgctgatcgccgaggtcgcgcaggccatggacatcaaggtggagctg
tccggcggcatccgcgacgacgacaccctcgccgccgcgctcgccaccggctgtacccgg
gtgaacctgggcacggccgccctggagacccccgagtgggtcgccaaggtcatcgccgag
cacggcgacaagatcgcggtcggcctggacgtacggggcaccacgctccgcggccgcggc
tggacccgcgacggcggcgacctctacgagacgctggaccgcctgaacaaggagggctgc
gcccgctacgtcgtcaccgacatcgccaaggacggcaccctccagggccccaacctggag
ctgctgaagaacgtctgcgcggccaccgaccgcccggtcgtggcgtcgggcggcgtctcc
tccctggacgacctgcgcgcgatcgccgggctcgtcccggccggtgtcgagggggccatc
gtcgggaaggccctgtacgcgaaggcgttcaccctggaagaagccttggaggctacgtcg
tga

DBGET integrated database retrieval system