KEGG   Streptomyces coelicolor: SCO2053Help
Entry
SCO2053           CDS       T00085                                 

Gene name
hisC1, SC4G6.22c
Definition
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco00350  Tyrosine metabolism
sco00360  Phenylalanine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00401  Novobiocin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO2053 (hisC1)
   00350 Tyrosine metabolism
    SCO2053 (hisC1)
   00360 Phenylalanine metabolism
    SCO2053 (hisC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2053 (hisC1)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO2053 (hisC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO2053 (hisC1)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SCO2053 (hisC1)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO2053 (hisC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1097487
NCBI-ProteinID: NP_626313
Kitasato: SCO2053
UniProt: P16246
Position
complement(2200129..2201238)
Genome map
AA seq 369 aa AA seqDB search
MTFGIDDLPVRDELRGKSPYGAPQLDVPVRLNTNENPYPLPEALVERIAERVREAARDLN
RYPDRDAVELRTQLARYLTDTSGHPLDVSNVWAANGSNEVIQQLLQTFGGPGRTAIGFEP
SYSMHGLIARGTGTGWISGPRHEDFTIDVPAATRAIDEHRPDVVFITTPNNPTGTAVPAE
TVLALYEAAQAAKPSMVVVDEAYIEFSHGASLLPLLDGRPNLVVSRTMSKAFGAAGLRLG
YLAAHPAVVDAVQLVRLPYHLSAVTQATALAALEHTDTLLKYVEQLKTERDRLVAELRAI
GYAVTESDANFVQFGRFADSHATWRKILDRGVLVRDNGVPGWLRVTAGTPEENDAFLDAV
REVKKEQHT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttcggcatcgacgatctccccgtacgggacgagctgcgcggcaagtccccctac
ggcgcgccccaactggacgtgccggtacggctgaacaccaacgagaacccctacccgctg
cccgaggcgctggtcgagcggatcgccgagcgggtccgcgaggccgcccgcgacctcaac
cgctaccccgaccgggacgcggtcgagctgcgcactcaactggcccggtacctgacggac
acctcgggacacccgctggacgtgagcaacgtctgggcggccaacggctccaacgaggtc
atccagcaactgctgcagaccttcggcgggccgggccgcaccgcgatcggcttcgagccg
tcgtactcgatgcacggcctcatcgcgcgcggcaccggcaccggctggatctccgggccg
cgccacgaggacttcaccatcgacgtgcccgccgccacgcgggcgatcgacgagcaccgc
ccggacgtcgtcttcatcaccacccccaacaaccccacgggaaccgcggtcccggccgag
acggtcctcgccctgtacgaggccgcccaggcggcgaagccgtccatggtcgtggtggac
gaggcgtacatcgagttcagccacggcgcctcgctgctgccgctgctcgacgggcggccg
aacctcgtcgtctcccgcacgatgtcgaaggcgttcggcgcggcgggcctgcgcctcggc
tacctggccgcgcacccggccgtcgtcgacgcggtccagctcgtacggctgccgtaccac
ctgtcggccgtgacgcaggcgaccgcgctggccgccctggagcacacggacacgctgctg
aagtacgtcgagcagctgaagaccgagcgggaccggctggtcgccgaactgcgcgccatc
ggctacgcggtgaccgagtccgacgcgaacttcgtccagttcgggcggttcgcggactcc
cacgcgacctggcggaagatcctcgaccggggcgtcctggtccgggacaacggcgtgccg
gggtggctgcgggtcaccgccggcactccggaggagaacgacgcgttcctcgacgcggta
cgtgaagtcaagaaggagcagcacacatga

DBGET integrated database retrieval system