KEGG   Streptomyces coelicolor: SCO2118Help
Entry
SCO2118           CDS       T00085                                 

Gene name
dldh2, SCE10.12c
Definition
(RefSeq) D-lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
sco  Streptomyces coelicolor
Pathway
sco00620  Pyruvate metabolism
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2118 (dldh2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     SCO2118 (dldh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1097552
NCBI-ProteinID: NP_626375
Kitasato: SCO2118
UniProt: Q9S2M5
Position
complement(2278559..2279554)
Genome map
AA seq 331 aa AA seqDB search
MEILAFGVQADEKPLIERAFRDHEDVRCLDVFLNEDTAPIAAGHEIVSTSVNADLGAAVL
EILAAGGTRMVAQRSTGFNNVDLDTADRLGMTVARVSYYSPHSVAEFAWALAMAVNRRIV
RASIRTRDFDFRLDGLMGRDLHGRTAGVLGTGKIGEAFARIAHGFGMRLLGWDVAENPAC
AELGMRYVAKDELLARSDLITLHVPLMAETRHLIDATALKAMRDDAILINSSRGGLIDTA
ALVGELRAGRFAGVGLDVYEAEAGLFFLDKSLEAVEDDTLARLVTFPNVLVTSHQAYYTE
DAVGQIVGTTVRNVLDYREGRRSENVLVPRS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagatccttgccttcggcgtccaggccgacgagaagcccctgatcgagcgggccttc
cgcgaccacgaggacgtccgctgcctggacgtcttcctcaacgaggacaccgcccccatc
gcggccggccacgagatcgtctccacgtccgtcaacgccgacctcggcgcggccgttctg
gagatcctcgcggccggcggcacccggatggtggcccagcgctccaccggcttcaacaac
gtcgacctggacaccgccgaccggctcggcatgaccgtcgcccgggtgtcgtactactcg
ccccactcggtcgccgagttcgcctgggccctcgccatggccgtcaaccggcggatcgtg
cgcgcctccatccgcacccgcgacttcgacttccggctcgacggactgatgggccgggac
ctgcacggccgcaccgccggcgtcctcggcaccggcaagatcggcgaggccttcgcccgg
atcgcccacggcttcggcatgcggctgctcggctgggacgtcgccgagaacccggcctgc
gccgaactgggcatgcgctacgtcgccaaggacgagctgctggcccgctccgacctgatc
accctgcacgtcccgctgatggccgagacccggcacctgatcgacgcgaccgccctgaag
gcgatgcgcgacgacgccatcctgatcaattccagccgcggcggcctgatcgacaccgcg
gccctcgtcggcgaactgcgcgcgggccgcttcgccggcgtcggcctggacgtgtacgag
gcggaggcgggcctgttcttcctcgacaagtccctggaggccgtcgaggacgacaccctg
gcccgcctcgtcaccttcccgaacgtcctggtcacctcgcaccaggcctactacaccgag
gacgccgtcggccagatcgtcggcacgacggtgcgcaacgtcctcgactaccgggagggc
cgccgctcggagaacgtgctcgtaccgcgcagctga

DBGET integrated database retrieval system