KEGG   Streptomyces coelicolor: SCO2122Help
Entry
SCO2122           CDS       T00085                                 

Gene name
SC6E10.16c
Definition
(RefSeq) hypothetical protein
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sco  Streptomyces coelicolor
Pathway
sco00561  Glycerolipid metabolism
sco00564  Glycerophospholipid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO2122 (SC6E10.16c)
   00564 Glycerophospholipid metabolism
    SCO2122 (SC6E10.16c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO2122 (SC6E10.16c)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SCO2122 (SC6E10.16c)
Lipid biosynthesis proteins [BR:sco01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SCO2122 (SC6E10.16c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase DUF374
Motif
Other DBs
NCBI-GeneID: 1097556
NCBI-ProteinID: NP_626379
Kitasato: SCO2122
UniProt: Q9S2M2
Position
complement(2282715..2283503)
Genome map
AA seq 262 aa AA seqDB search
MLYGAMKVTVGGSLKLAFRPWVEGLEHIPADGPAILASNHLSFSDSFFLPAVLDRKVTFI
AKAEYFNTPGVKGRLTAAFFKGVGQLPVDRSGARGAGEAAIKSGIEVLERGELFGIYPEG
TRSPDGRLYRGKPGGLARVALATGAPVVPVAMIDTEKIQPPGQVMPKLMRPGIRIGKPLD
FSRYQGMEHDRFVLRAVTDEVMYEIMKLSGQEYVDMYATAMKRQLAEAAKAEKAAKAEKA
AKNDKAAKNDKAAKAGTDRAGT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgttgtacggcgcgatgaaggtcaccgtcggggggtcgctgaagctcgccttccggccc
tgggtggagggcctggagcacatcccggccgacggccccgccatcctggcgagcaaccac
ctgtcgttctccgactcgttcttcctgccggccgtcctcgaccgcaaggtgaccttcatc
gccaaggccgagtacttcaacacccccggggtcaagggccggctgaccgccgccttcttc
aagggcgtgggccagctcccggtggaccgctccggcgcgcgcggtgcgggggaggccgcc
atcaagagcggcatagaggtcctggagcgcggcgagctgttcgggatctaccccgagggc
acccgctccccggacgggcgcctctaccgcggcaagccgggcgggctggcccgcgtggcc
ctcgccaccggggcgcccgtcgtcccggtcgccatgatcgacaccgagaagatccagccg
cccggccaggtgatgccgaagctgatgcggcccggcatccgcatcggcaagccgctggac
ttctcccgctaccagggcatggagcacgaccgcttcgtactccgcgcggtgaccgacgag
gtcatgtacgagatcatgaagctctccggccaggagtacgtcgacatgtacgcgaccgcc
atgaagcggcagctcgcggaggcggcgaaggccgagaaggcggcgaaggccgagaaggcg
gccaagaacgacaaggcggccaagaacgacaaggcagcgaaggccgggacggaccgggcc
ggcacgtag

DBGET integrated database retrieval system